Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (10 Feb 2021)
Sequence version 2 (15 May 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Atlastin-2

Gene

ATL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis (PubMed:18270207, PubMed:19665976, PubMed:27619977).3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi101 – 108GTPBy similarity8
Nucleotide bindingi145 – 147GTPBy similarity3
Nucleotide bindingi244 – 245GTPBy similarity2
Nucleotide bindingi303 – 306GTPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NHH9

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.390.1.1, the tmcc/tex28 (tm-tex) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Atlastin-2 (EC:3.6.5.-)
Alternative name(s):
ADP-ribosylation factor-like protein 6-interacting protein 2
Short name:
ARL-6-interacting protein 2
Short name:
Aip-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATL2
Synonyms:ARL6IP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24047, ATL2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609368, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NHH9

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000119787.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 476Cytoplasmic1 PublicationAdd BLAST476
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei477 – 497HelicalSequence analysisAdd BLAST21
Topological domaini498 – 499LumenalSequence analysis2
Transmembranei500 – 520HelicalSequence analysisAdd BLAST21
Topological domaini521 – 583Cytoplasmic1 PublicationAdd BLAST63

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi107K → A: Alters endoplasmic reticulum morphology. 2 Publications1
Mutagenesisi244R → Q: Alters endoplasmic reticulum morphogenesis. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
64225

Open Targets

More...
OpenTargetsi
ENSG00000119787

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164716322

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NHH9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147742983

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002871051 – 583Atlastin-2Add BLAST583

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineCombined sources1
Modified residuei270N6-methyllysineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NHH9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NHH9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NHH9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NHH9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NHH9

PeptideAtlas

More...
PeptideAtlasi
Q8NHH9

PRoteomics IDEntifications database

More...
PRIDEi
Q8NHH9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6903
73710 [Q8NHH9-1]
73711 [Q8NHH9-2]
73712 [Q8NHH9-3]
73713 [Q8NHH9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NHH9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NHH9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in peripheral tissues (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119787, Expressed in secondary oocyte and 230 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NHH9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NHH9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000119787, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with REEP5 and RTN3 (PubMed:19665976).

Interacts with ZFYVE27 (PubMed:23969831).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122115, 49 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8NHH9

Protein interaction database and analysis system

More...
IntActi
Q8NHH9, 37 interactors

Molecular INTeraction database

More...
MINTi
Q8NHH9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000368237

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NHH9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NHH9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini91 – 336GB1/RHD3-type GPROSITE-ProRule annotationAdd BLAST246

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili256 – 284Sequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class dynamin-like GTPase superfamily. GB1/RHD3 GTPase family. GB1 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2037, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155710

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021447_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NHH9

Identification of Orthologs from Complete Genome Data

More...
OMAi
FREVGTM

Database of Orthologous Groups

More...
OrthoDBi
1027269at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NHH9

TreeFam database of animal gene trees

More...
TreeFami
TF105251

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030386, G_GB1_RHD3_dom
IPR003191, Guanylate-bd/ATL_C
IPR036543, Guanylate-bd_C_sf
IPR015894, Guanylate-bd_N
IPR027417, P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02263, GBP, 1 hit
PF02841, GBP_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48340, SSF48340, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51715, G_GB1_RHD3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NHH9-1) [UniParc]FASTAAdd to basket
Also known as: AT2b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEGDEAARG QQPHQGLWRR RRTSDPSAAV NHVSSTTSLG ENYEDDDLVN
60 70 80 90 100
SDEVMKKPCP VQIVLAHEDD HNFELDEEAL EQILLQEHIR DLNIVVVSVA
110 120 130 140 150
GAFRKGKSFL LDFMLRYMYN KDSQSWIGGN NEPLTGFTWR GGCERETTGI
160 170 180 190 200
QVWNEVFVID RPNGTKVAVL LMDTQGAFDS QSTIKDCATV FALSTMTSSV
210 220 230 240 250
QVYNLSQNIQ EDDLQHLQLF TEYGRLAMEE IYQKPFQTLM FLIRDWSYPY
260 270 280 290 300
EHSYGLEGGK QFLEKRLQVK QNQHEELQNV RKHIHNCFSN LGCFLLPHPG
310 320 330 340 350
LKVATNPSFD GRLKDIDEDF KRELRNLVPL LLAPENLVEK EISGSKVTCR
360 370 380 390 400
DLVEYFKAYI KIYQGEELPH PKSMLQATAE ANNLAAVAGA RDTYCKSMEQ
410 420 430 440 450
VCGGDKPYIA PSDLERKHLD LKEVAIKQFR SVKKMGGDEF CRRYQDQLEA
460 470 480 490 500
EIEETYANFI KHNDGKNIFY AARTPATLFA VMFAMYIISG LTGFIGLNSI
510 520 530 540 550
AVLCNLVMGL ALIFLCTWAY VKYSGEFREI GTVIDQIAET LWEQVLKPLG
560 570 580
DNLMEENIRQ SVTNSIKAGL TDQVSHHARL KTD
Length:583
Mass (Da):66,229
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i885738C43996DEBF
GO
Isoform 2 (identifier: Q8NHH9-2) [UniParc]FASTAAdd to basket
Also known as: AT2a

The sequence of this isoform differs from the canonical sequence as follows:
     546-583: LKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD → FSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKKN

Show »
Length:579
Mass (Da):66,087
Checksum:i8C9D170C429AAA71
GO
Isoform 3 (identifier: Q8NHH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-171: Missing.

Show »
Length:412
Mass (Da):46,918
Checksum:iBA8D07DFDED793AF
GO
Isoform 4 (identifier: Q8NHH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF
     545-583: VLKPLGDNLM...VSHHARLKTD → RSPRKVFSKL...LSSNNNKKKN

Show »
Length:566
Mass (Da):65,004
Checksum:i6D82F46C7FCB8490
GO
Isoform 5 (identifier: Q8NHH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF

Show »
Length:565
Mass (Da):64,522
Checksum:i9E1671FFF406376A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C3A2H7C3A2_HUMAN
Atlastin-2
ATL2
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MCN0B5MCN0_HUMAN
Atlastin-2
ATL2
413Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQQ5C9JQQ5_HUMAN
Atlastin-2
ATL2
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JC25C9JC25_HUMAN
Atlastin-2
ATL2
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBH0F8WBH0_HUMAN
Atlastin-2
ATL2
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WD17F8WD17_HUMAN
Atlastin-2
ATL2
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEN4F8WEN4_HUMAN
Atlastin-2
ATL2
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti509G → E in BAB15598 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03226518W → R1 PublicationCorresponds to variant dbSNP:rs3731847Ensembl.1
Natural variantiVAR_032266272N → S. Corresponds to variant dbSNP:rs34873284Ensembl.1
Natural variantiVAR_032267420D → H. Corresponds to variant dbSNP:rs7582826Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0253091 – 171Missing in isoform 3. 1 PublicationAdd BLAST171
Alternative sequenceiVSP_0416041 – 39MAEGD…STTSL → MVLKKGIKFFQRLINSKSLR F in isoform 4 and isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_041605545 – 583VLKPL…RLKTD → RSPRKVFSKLFEVTRRRMVH RALSSAQRQRLSSNNNKKKN in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_025310546 – 583LKPLG…RLKTD → FSKLFEVTRRRMVHRALSSA QRQRLSSNNNKKKN in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF449187 AF449186 Genomic DNA Translation: AAM97341.1
AF449187 AF449186 Genomic DNA Translation: AAM97342.1
AK026946 mRNA Translation: BAB15598.1
AK294049 mRNA Translation: BAH11658.1
AK302621 mRNA Translation: BAH13764.1
AK225190 mRNA No translation available.
AC016995 Genomic DNA Translation: AAX88950.1
BC053508 mRNA Translation: AAH53508.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1795.1 [Q8NHH9-2]
CCDS46260.1 [Q8NHH9-1]
CCDS77402.1 [Q8NHH9-5]
CCDS86831.1 [Q8NHH9-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001129145.1, NM_001135673.3 [Q8NHH9-1]
NP_001295005.1, NM_001308076.1 [Q8NHH9-5]
NP_001317387.1, NM_001330458.1 [Q8NHH9-3]
NP_001317388.1, NM_001330459.1 [Q8NHH9-4]
NP_001317389.1, NM_001330460.1
NP_071769.2, NM_022374.4 [Q8NHH9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000378954; ENSP00000368237; ENSG00000119787 [Q8NHH9-1]
ENST00000402054; ENSP00000384062; ENSG00000119787 [Q8NHH9-3]
ENST00000419554; ENSP00000415336; ENSG00000119787 [Q8NHH9-2]
ENST00000452935; ENSP00000390743; ENSG00000119787 [Q8NHH9-5]
ENST00000651368; ENSP00000498813; ENSG00000119787 [Q8NHH9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64225

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64225

UCSC genome browser

More...
UCSCi
uc002rqq.4, human [Q8NHH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF449187 AF449186 Genomic DNA Translation: AAM97341.1
AF449187 AF449186 Genomic DNA Translation: AAM97342.1
AK026946 mRNA Translation: BAB15598.1
AK294049 mRNA Translation: BAH11658.1
AK302621 mRNA Translation: BAH13764.1
AK225190 mRNA No translation available.
AC016995 Genomic DNA Translation: AAX88950.1
BC053508 mRNA Translation: AAH53508.1
CCDSiCCDS1795.1 [Q8NHH9-2]
CCDS46260.1 [Q8NHH9-1]
CCDS77402.1 [Q8NHH9-5]
CCDS86831.1 [Q8NHH9-3]
RefSeqiNP_001129145.1, NM_001135673.3 [Q8NHH9-1]
NP_001295005.1, NM_001308076.1 [Q8NHH9-5]
NP_001317387.1, NM_001330458.1 [Q8NHH9-3]
NP_001317388.1, NM_001330459.1 [Q8NHH9-4]
NP_001317389.1, NM_001330460.1
NP_071769.2, NM_022374.4 [Q8NHH9-2]

3D structure databases

SMRiQ8NHH9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122115, 49 interactors
CORUMiQ8NHH9
IntActiQ8NHH9, 37 interactors
MINTiQ8NHH9
STRINGi9606.ENSP00000368237

Protein family/group databases

TCDBi9.B.390.1.1, the tmcc/tex28 (tm-tex) family

PTM databases

iPTMnetiQ8NHH9
PhosphoSitePlusiQ8NHH9

Genetic variation databases

BioMutaiATL2
DMDMi147742983

Proteomic databases

EPDiQ8NHH9
jPOSTiQ8NHH9
MassIVEiQ8NHH9
MaxQBiQ8NHH9
PaxDbiQ8NHH9
PeptideAtlasiQ8NHH9
PRIDEiQ8NHH9
ProteomicsDBi6903
73710 [Q8NHH9-1]
73711 [Q8NHH9-2]
73712 [Q8NHH9-3]
73713 [Q8NHH9-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29481, 119 antibodies

Genome annotation databases

EnsembliENST00000378954; ENSP00000368237; ENSG00000119787 [Q8NHH9-1]
ENST00000402054; ENSP00000384062; ENSG00000119787 [Q8NHH9-3]
ENST00000419554; ENSP00000415336; ENSG00000119787 [Q8NHH9-2]
ENST00000452935; ENSP00000390743; ENSG00000119787 [Q8NHH9-5]
ENST00000651368; ENSP00000498813; ENSG00000119787 [Q8NHH9-3]
GeneIDi64225
KEGGihsa:64225
UCSCiuc002rqq.4, human [Q8NHH9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64225
DisGeNETi64225

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATL2
HGNCiHGNC:24047, ATL2
HPAiENSG00000119787, Low tissue specificity
MIMi609368, gene
neXtProtiNX_Q8NHH9
OpenTargetsiENSG00000119787
PharmGKBiPA164716322
VEuPathDBiHostDB:ENSG00000119787.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2037, Eukaryota
GeneTreeiENSGT00940000155710
HOGENOMiCLU_021447_2_1_1
InParanoidiQ8NHH9
OMAiFREVGTM
OrthoDBi1027269at2759
PhylomeDBiQ8NHH9
TreeFamiTF105251

Enzyme and pathway databases

PathwayCommonsiQ8NHH9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
64225, 445 hits in 877 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATL2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64225
PharosiQ8NHH9, Tbio

Protein Ontology

More...
PROi
PR:Q8NHH9
RNActiQ8NHH9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119787, Expressed in secondary oocyte and 230 other tissues
ExpressionAtlasiQ8NHH9, baseline and differential
GenevisibleiQ8NHH9, HS

Family and domain databases

InterProiView protein in InterPro
IPR030386, G_GB1_RHD3_dom
IPR003191, Guanylate-bd/ATL_C
IPR036543, Guanylate-bd_C_sf
IPR015894, Guanylate-bd_N
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF02263, GBP, 1 hit
PF02841, GBP_C, 1 hit
SUPFAMiSSF48340, SSF48340, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51715, G_GB1_RHD3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATLA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NHH9
Secondary accession number(s): B7Z1X2
, B7Z7X8, Q4ZG30, Q7Z630, Q8NHH8, Q9H5M7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: February 10, 2021
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  5. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again