Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NFT2 (STEA2_HUMAN)

Entry version 151 (02 Jun 2021)
Sequence version 3 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Metalloreductase STEAP2

Gene

STEAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor (By similarity).

By similarity

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei118NADP; via amide nitrogenBy similarity1
Binding sitei151NADP; via amide nitrogenBy similarity1
Binding sitei152FADBy similarity1
Binding sitei160FADBy similarity1
Binding sitei281FADBy similarity1
Binding sitei302FADBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi316Iron (heme axial ligand)By similarity1
Binding sitei378FADBy similarity1
Binding sitei395FADBy similarity1
Metal bindingi409Iron (heme axial ligand)By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi38 – 41NADPBy similarity4
Nucleotide bindingi60 – 61NADPBy similarity2
Nucleotide bindingi93 – 100NADPBy similarity8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processElectron transport, Ion transport, Iron transport, Transport
LigandCopper, FAD, Flavoprotein, Heme, Iron, Metal-binding, NAD, NADP

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NFT2

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-917977, Transferrin endocytosis and recycling

Protein family/group databases

Transport Classification Database

More...TCDBi		5.B.6.1.2, the transmembrane epithelial antigen protein-3 ferric reductase (steap) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Metalloreductase STEAP2 (EC:1.16.1.-)
Alternative name(s):
Prostate cancer-associated protein 1
Protein up-regulated in metastatic prostate cancer
Short name:
PUMPCn
Six-transmembrane epithelial antigen of prostate 2
SixTransMembrane protein of prostate 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STEAP2
Synonyms:PCANAP1, STAMP1
ORF Names:UNQ6507/PRO23203
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:17885, STEAP2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605094, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NFT2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000157214.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei208 – 228HelicalSequence analysisAdd BLAST21
Transmembranei259 – 279HelicalSequence analysisAdd BLAST21
Transmembranei305 – 325HelicalSequence analysisAdd BLAST21
Transmembranei359 – 379HelicalSequence analysisAdd BLAST21
Transmembranei393 – 413HelicalSequence analysisAdd BLAST21
Transmembranei432 – 452HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		261729

Open Targets

More...OpenTargetsi		ENSG00000157214

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38473

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NFT2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STEAP2

Domain mapping of disease mutations (DMDM)

More...DMDMi		296452950

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001916971 – 490Metalloreductase STEAP2Add BLAST490

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei483PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NFT2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NFT2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NFT2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NFT2

PeptideAtlas

More...PeptideAtlasi		Q8NFT2

PRoteomics IDEntifications database

More...PRIDEi		Q8NFT2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33900
73348 [Q8NFT2-1]
73349 [Q8NFT2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NFT2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NFT2

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8NFT2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000157214, Expressed in prostate gland and 208 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NFT2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NFT2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000157214, Tissue enriched (prostate)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		129285, 8 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8NFT2

Protein interaction database and analysis system

More...IntActi		Q8NFT2, 7 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000378119

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NFT2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NFT2

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini259 – 407Ferric oxidoreductaseAdd BLAST149

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the STEAP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QVSJ, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000008042

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NFT2

Identification of Orthologs from Complete Genome Data

More...OMAi		HVVYSLC

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NFT2

TreeFam database of animal gene trees

More...TreeFami		TF332031

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013130, Fe3_Rdtase_TM_dom
IPR036291, NAD(P)-bd_dom_sf
IPR028939, P5C_Rdtase_cat_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03807, F420_oxidored, 1 hit
PF01794, Ferric_reduct, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF51735, SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NFT2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESISMMGSP KSLSETFLPN GINGIKDARK VTVGVIGSGD FAKSLTIRLI 
        60         70         80         90        100
RCGYHVVIGS RNPKFASEFF PHVVDVTHHE DALTKTNIIF VAIHREHYTS 
       110        120        130        140        150
LWDLRHLLVG KILIDVSNNM RINQYPESNA EYLASLFPDS LIVKGFNVVS 
       160        170        180        190        200
AWALQLGPKD ASRQVYICSN NIQARQQVIE LARQLNFIPI DLGSLSSARE 
       210        220        230        240        250
IENLPLRLFT LWRGPVVVAI SLATFFFLYS FVRDVIHPYA RNQQSDFYKI 
       260        270        280        290        300
PIEIVNKTLP IVAITLLSLV YLAGLLAAAY QLYYGTKYRR FPPWLETWLQ 
       310        320        330        340        350
CRKQLGLLSF FFAMVHVAYS LCLPMRRSER YLFLNMAYQQ VHANIENSWN 
       360        370        380        390        400
EEEVWRIEMY ISFGIMSLGL LSLLAVTSIP SVSNALNWRE FSFIQSTLGY 
       410        420        430        440        450
VALLISTFHV LIYGWKRAFE EEYYRFYTPP NFVLALVLPS IVILGKIILF 
       460        470        480        490
LPCISRKLKR IKKGWEKSQF LEEGMGGTIP HVSPERVTVM
Length:490
Mass (Da):56,056
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB12E252DE3F4CAF
GO
Isoform 2 (identifier: Q8NFT2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     445-490: GKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM → DLLQLCRYPD

Show »
Length:454
Mass (Da):52,052
Checksum:i1471E787D19E3E21
GO
Isoform 3 (identifier: Q8NFT2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-490: STLGYVALLI...HVSPERVTVM → IFCSFADTQTELELEFVFLLTLLL

Show »
Length:419
Mass (Da):47,916
Checksum:i97C4B47BD22DA168
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MC02B5MC02_HUMAN
Metalloreductase STEAP2
STEAP2
403Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLP2C9JLP2_HUMAN
Metalloreductase STEAP2
STEAP2
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JHX5C9JHX5_HUMAN
Metalloreductase STEAP2
STEAP2
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti17F → V in AAN04080 (PubMed:12429817).Curated1
Sequence conflicti211L → F in AAG32148 (PubMed:12095985).Curated1
Sequence conflicti211L → F in AAG32149 (PubMed:12095985).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06038717F → CCombined sources4 PublicationsCorresponds to variant dbSNP:rs194520Ensembl.1
Natural variantiVAR_06038840D → Y. Corresponds to variant dbSNP:rs17863046Ensembl.1
Natural variantiVAR_057727214G → E. Corresponds to variant dbSNP:rs13228098Ensembl.1
Natural variantiVAR_057728456R → Q1 PublicationCorresponds to variant dbSNP:rs194524Ensembl.1
Natural variantiVAR_060389475M → I4 PublicationsCorresponds to variant dbSNP:rs194525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045590396 – 490STLGY…RVTVM → IFCSFADTQTELELEFVFLL TLLL in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_030999445 – 490GKIIL…RVTVM → DLLQLCRYPD in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY008444 mRNA Translation: AAG32148.1
AY008445 mRNA Translation: AAG32149.1
AF455138 mRNA Translation: AAN04080.1
AF526382 mRNA Translation: AAQ08976.1
AY358267 mRNA Translation: AAQ88634.1
AC002064 Genomic DNA No translation available.
AC004969 Genomic DNA No translation available.
CH236949 Genomic DNA Translation: EAL24165.1
CH471091 Genomic DNA Translation: EAW76890.1
CH471091 Genomic DNA Translation: EAW76894.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43612.1 [Q8NFT2-2]
CCDS5615.1 [Q8NFT2-1]
CCDS59064.1 [Q8NFT2-3]

NCBI Reference Sequences

More...RefSeqi		NP_001035755.1, NM_001040665.1 [Q8NFT2-1]
NP_001035756.1, NM_001040666.1 [Q8NFT2-2]
NP_001231873.1, NM_001244944.1 [Q8NFT2-1]
NP_001231875.1, NM_001244946.1 [Q8NFT2-3]
NP_694544.2, NM_152999.3 [Q8NFT2-1]
XP_006715984.1, XM_006715921.3 [Q8NFT2-1]
XP_016867442.1, XM_017011953.1 [Q8NFT2-1]
XP_016867443.1, XM_017011954.1 [Q8NFT2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000287908; ENSP00000287908; ENSG00000157214 [Q8NFT2-1]
ENST00000394621; ENSP00000378119; ENSG00000157214 [Q8NFT2-1]
ENST00000394622; ENSP00000378120; ENSG00000157214 [Q8NFT2-1]
ENST00000394626; ENSP00000378123; ENSG00000157214 [Q8NFT2-2]
ENST00000394629; ENSP00000378125; ENSG00000157214 [Q8NFT2-2]
ENST00000394632; ENSP00000378128; ENSG00000157214 [Q8NFT2-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		261729

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:261729

UCSC genome browser

More...UCSCi		uc003ujz.4, human [Q8NFT2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY008444 mRNA Translation: AAG32148.1
AY008445 mRNA Translation: AAG32149.1
AF455138 mRNA Translation: AAN04080.1
AF526382 mRNA Translation: AAQ08976.1
AY358267 mRNA Translation: AAQ88634.1
AC002064 Genomic DNA No translation available.
AC004969 Genomic DNA No translation available.
CH236949 Genomic DNA Translation: EAL24165.1
CH471091 Genomic DNA Translation: EAW76890.1
CH471091 Genomic DNA Translation: EAW76894.1
CCDSiCCDS43612.1 [Q8NFT2-2]
CCDS5615.1 [Q8NFT2-1]
CCDS59064.1 [Q8NFT2-3]
RefSeqiNP_001035755.1, NM_001040665.1 [Q8NFT2-1]
NP_001035756.1, NM_001040666.1 [Q8NFT2-2]
NP_001231873.1, NM_001244944.1 [Q8NFT2-1]
NP_001231875.1, NM_001244946.1 [Q8NFT2-3]
NP_694544.2, NM_152999.3 [Q8NFT2-1]
XP_006715984.1, XM_006715921.3 [Q8NFT2-1]
XP_016867442.1, XM_017011953.1 [Q8NFT2-1]
XP_016867443.1, XM_017011954.1 [Q8NFT2-1]

3D structure databases

SMRiQ8NFT2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi129285, 8 interactors
CORUMiQ8NFT2
IntActiQ8NFT2, 7 interactors
STRINGi9606.ENSP00000378119

Protein family/group databases

TCDBi5.B.6.1.2, the transmembrane epithelial antigen protein-3 ferric reductase (steap) family

PTM databases

iPTMnetiQ8NFT2
PhosphoSitePlusiQ8NFT2
SwissPalmiQ8NFT2

Genetic variation databases

BioMutaiSTEAP2
DMDMi296452950

Proteomic databases

jPOSTiQ8NFT2
MassIVEiQ8NFT2
MaxQBiQ8NFT2
PaxDbiQ8NFT2
PeptideAtlasiQ8NFT2
PRIDEiQ8NFT2
ProteomicsDBi33900
73348 [Q8NFT2-1]
73349 [Q8NFT2-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		29828, 209 antibodies

The DNASU plasmid repository

More...DNASUi		261729

Genome annotation databases

EnsembliENST00000287908; ENSP00000287908; ENSG00000157214 [Q8NFT2-1]
ENST00000394621; ENSP00000378119; ENSG00000157214 [Q8NFT2-1]
ENST00000394622; ENSP00000378120; ENSG00000157214 [Q8NFT2-1]
ENST00000394626; ENSP00000378123; ENSG00000157214 [Q8NFT2-2]
ENST00000394629; ENSP00000378125; ENSG00000157214 [Q8NFT2-2]
ENST00000394632; ENSP00000378128; ENSG00000157214 [Q8NFT2-3]
GeneIDi261729
KEGGihsa:261729
UCSCiuc003ujz.4, human [Q8NFT2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		261729
DisGeNETi261729

GeneCards: human genes, protein and diseases

More...GeneCardsi		STEAP2
HGNCiHGNC:17885, STEAP2
HPAiENSG00000157214, Tissue enriched (prostate)
MIMi605094, gene
neXtProtiNX_Q8NFT2
OpenTargetsiENSG00000157214
PharmGKBiPA38473
VEuPathDBiHostDB:ENSG00000157214.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QVSJ, Eukaryota
GeneTreeiENSGT00390000008042
InParanoidiQ8NFT2
OMAiHVVYSLC
PhylomeDBiQ8NFT2
TreeFamiTF332031

Enzyme and pathway databases

PathwayCommonsiQ8NFT2
ReactomeiR-HSA-917977, Transferrin endocytosis and recycling

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		261729, 10 hits in 989 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		STEAP2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		STEAP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		261729
PharosiQ8NFT2, Tbio

Protein Ontology

More...PROi		PR:Q8NFT2
RNActiQ8NFT2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000157214, Expressed in prostate gland and 208 other tissues
ExpressionAtlasiQ8NFT2, baseline and differential
GenevisibleiQ8NFT2, HS

Family and domain databases

InterProiView protein in InterPro
IPR013130, Fe3_Rdtase_TM_dom
IPR036291, NAD(P)-bd_dom_sf
IPR028939, P5C_Rdtase_cat_N
PfamiView protein in Pfam
PF03807, F420_oxidored, 1 hit
PF01794, Ferric_reduct, 1 hit
SUPFAMiSSF51735, SSF51735, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTEA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NFT2
Secondary accession number(s): A4D1F1
, G5E9C6, Q6UXN6, Q6YPB1, Q8IUE7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: May 18, 2010
Last modified: June 2, 2021
This is version 151 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again