Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Carbohydrate sulfotransferase 13

Gene

CHST13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. No activity toward dermatan.

Catalytic activityi

3'-phosphoadenylyl sulfate + chondroitin = adenosine 3',5'-bisphosphate + chondroitin 4'-sulfate.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi113 – 119PAPSBy similarity7
Nucleotide bindingi174 – 182PAPSBy similarity9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processCarbohydrate metabolism

Enzyme and pathway databases

BioCyciMetaCyc:HS11524-MONOMER
BRENDAi2.8.2.5 2681
ReactomeiR-HSA-2022870 Chondroitin sulfate biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Carbohydrate sulfotransferase 13 (EC:2.8.2.5)
Alternative name(s):
Chondroitin 4-O-sulfotransferase 3
Chondroitin 4-sulfotransferase 3
Short name:
C4ST-3
Short name:
C4ST3
Gene namesi
Name:CHST13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000180767.9
HGNCiHGNC:21755 CHST13
MIMi610124 gene
neXtProtiNX_Q8NET6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 9CytoplasmicSequence analysis9
Transmembranei10 – 30Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini31 – 341LumenalSequence analysisAdd BLAST311

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi166012
OpenTargetsiENSG00000180767
PharmGKBiPA134976803

Polymorphism and mutation databases

BioMutaiCHST13

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001896711 – 341Carbohydrate sulfotransferase 13Add BLAST341

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei139PhosphoserineCombined sources1
Glycosylationi331N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8NET6
MaxQBiQ8NET6
PaxDbiQ8NET6
PeptideAtlasiQ8NET6
PRIDEiQ8NET6
ProteomicsDBi73215

PTM databases

iPTMnetiQ8NET6
PhosphoSitePlusiQ8NET6

Expressioni

Tissue specificityi

Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney.1 Publication

Gene expression databases

BgeeiENSG00000180767 Expressed in 80 organ(s), highest expression level in right lobe of liver
CleanExiHS_CHST13
ExpressionAtlasiQ8NET6 baseline and differential
GenevisibleiQ8NET6 HS

Interactioni

Protein-protein interaction databases

BioGridi127923, 2 interactors
IntActiQ8NET6, 2 interactors
STRINGi9606.ENSP00000317404

Structurei

3D structure databases

ProteinModelPortaliQ8NET6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi132 – 134Cell attachment siteSequence analysis3

Sequence similaritiesi

Belongs to the sulfotransferase 2 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4651 Eukaryota
ENOG4111GJR LUCA
GeneTreeiENSGT00760000119214
HOGENOMiHOG000132921
HOVERGENiHBG050952
InParanoidiQ8NET6
KOiK07779
OMAiEFVYYLV
OrthoDBiEOG091G0FZO
PhylomeDBiQ8NET6
TreeFamiTF325581

Family and domain databases

InterProiView protein in InterPro
IPR018011 Carb_sulfotrans_8-10
IPR005331 Sulfotransferase
PANTHERiPTHR12137 PTHR12137, 1 hit
PfamiView protein in Pfam
PF03567 Sulfotransfer_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q8NET6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRRCCRRRV LAAACLGAAL LLLCAAPRSL RPAFGNRALG SSWLGGEKRS
60 70 80 90 100
PLQKLYDLDQ DPRSTLAKVH RQRRDLLNSA CSRHSRRQRL LQPEDLRHVL
110 120 130 140 150
VDDAHGLLYC YVPKVACTNW KRVLLALSGQ ARGDPRAISA QEAHAPGRLP
160 170 180 190 200
SLADFSPAEI NRRLRAYLAF LFVREPFERL ASAYRNKLAR PYSAAFQRRY
210 220 230 240 250
GARIVQRLRP RALPDARARG HDVRFAEFLA YLLDPRTRRE EPFNEHWERA
260 270 280 290 300
HALCHPCRLR YDVVGKFETL AEDAAFVLGL AGASDLSFPG PPRPRGAAAS
310 320 330 340
RDLAARLFRD ISPFYQRRLF DLYKMDFLLF NYSAPSYLRL L
Length:341
Mass (Da):38,920
Last modified:October 1, 2002 - v1
Checksum:iA372134675D661F6
GO
Isoform 2 (identifier: Q8NET6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-225: PYSAAFQRRYGARIVQRLRPRALPDARARGHDVRF → TRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
     226-341: Missing.

Note: No experimental confirmation available.
Show »
Length:225
Mass (Da):25,489
Checksum:i921FAF275E2C5607
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WU70A0A087WU70_HUMAN
Carbohydrate sulfotransferase
CHST13
225Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053698146P → S. Corresponds to variant dbSNP:rs34311016Ensembl.1
Natural variantiVAR_021477271A → V1 PublicationCorresponds to variant dbSNP:rs1056523Ensembl.1
Natural variantiVAR_021478317R → Q1 PublicationCorresponds to variant dbSNP:rs1056522Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057175191 – 225PYSAA…HDVRF → TRSATRVASATTSWASSRRW RRTRPSCWAWRAHPT in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_057176226 – 341Missing in isoform 2. 1 PublicationAdd BLAST116

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY120869 mRNA Translation: AAM55481.1
BC103895 mRNA Translation: AAI03896.1
BC103896 mRNA Translation: AAI03897.1
BC103897 mRNA Translation: AAI03898.1
CCDSiCCDS3039.1 [Q8NET6-1]
RefSeqiNP_690849.1, NM_152889.2 [Q8NET6-1]
UniGeneiHs.292375

Genome annotation databases

EnsembliENST00000319340; ENSP00000317404; ENSG00000180767 [Q8NET6-1]
GeneIDi166012
KEGGihsa:166012
UCSCiuc003eja.4 human [Q8NET6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCHSTD_HUMAN
AccessioniPrimary (citable) accession number: Q8NET6
Secondary accession number(s): Q3SYA3, Q3SYA5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: October 1, 2002
Last modified: September 12, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again