Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (07 Apr 2021)
Sequence version 2 (03 Apr 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Cytosolic carboxypeptidase 3

Gene

AGBL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metallocarboxypeptidase that mediates both deglutamylation and deaspartylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates or polyaspartates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin.1 Publication
Metallocarboxypeptidase that mediates tubulin deglutamylation.1 Publication

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi364ZincBy similarity1
Metal bindingi367ZincBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei414NucleophileBy similarity1
Metal bindingi460ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NEM8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M14.026

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic carboxypeptidase 3 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AGBL3
Synonyms:CCP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27981, AGBL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617346, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NEM8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000146856.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
340351

Open Targets

More...
OpenTargetsi
ENSG00000146856

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672635

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NEM8, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
AGBL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
143955274

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002837511 – 1001Cytosolic carboxypeptidase 3Add BLAST1001

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NEM8

PeptideAtlas

More...
PeptideAtlasi
Q8NEM8

PRoteomics IDEntifications database

More...
PRIDEi
Q8NEM8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
73184 [Q8NEM8-1]
73185 [Q8NEM8-2]
73186 [Q8NEM8-3]
73187 [Q8NEM8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NEM8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NEM8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146856, Expressed in esophagogastric junction muscularis propria and 124 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NEM8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NEM8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000146856, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
131041, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NEM8, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000388275

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NEM8, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1814, Eukaryota
KOG3641, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160916

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_318835_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NEM8

Identification of Orthologs from Complete Genome Data

More...
OMAi
NCDNTLM

Database of Orthologous Groups

More...
OrthoDBi
481670at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NEM8

TreeFam database of animal gene trees

More...
TreeFami
TF313794

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040626, Pepdidase_M14_N
IPR000834, Peptidase_M14

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18027, Pepdidase_M14_N, 1 hit
PF00246, Peptidase_M14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NEM8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEDSEKEDY SDRTISDEDE SDEDMFMKFV SEDLHRCALL TADSFGDPFF
60 70 80 90 100
PRTTQILLEY QLGRWVPRLR EPRDLYGVSS SGPLSPTRWP YHCEVIDEKV
110 120 130 140 150
QHIDWTPSCP EPVYIPTGLE TEPLYPDSKE ATVVYLAEDA YKEPCFVYSR
160 170 180 190 200
VGGNRTPLKQ PVDYRDNTLM FEARFESGNL QKVVKVAEYE YQLTVRPDLF
210 220 230 240 250
TNKHTQWYYF QVTNMRAGIV YRFTIVNFTK PASLYSRGMR PLFYSEKEAK
260 270 280 290 300
AHHIGWQRIG DQIKYYRNNP GQDGRHYFSL TWTFQFPHNK DTCYFAHCYP
310 320 330 340 350
YTYTNLQEYL SGINNDPVRS KFCKIRVLCH TLARNMVYIL TITTPLKNSD
360 370 380 390 400
SRKRKAVILT ARVHPGETNS SWIMKGFLDY ILGNSSDAQL LRDTFVFKVV
410 420 430 440 450
PMLNPDGVIV GNYRCSLAGR DLNRNYTSLL KESFPSVWYT RNMVHRLMEK
460 470 480 490 500
REVILYCDLH GHSRKENIFM YGCDGSDRSK TLYLQQRIFP LMLSKNCPDK
510 520 530 540 550
FSFSACKFNV QKSKEGTGRV VMWKMGIRNS FTMEATFCGS TLGNKRGTHF
560 570 580 590 600
STKDLESMGY HFCDSLLDYC DPDRTKYYRC LKELEEMERH ITLEKVFEDS
610 620 630 640 650
DTPVIDITLD VESSSRGSDS SESIDSLTYL LKLTSQKKHL KTKKERNSTI
660 670 680 690 700
ASHQNARGQE VYDRGHLLQR HTQSNSDVKD TRPNEPDDYM VDYFRRQLPN
710 720 730 740 750
QGLAHCKLRL PGSRHSPASA SRVAGTTGTR HHTWLIFVFL VEMGKKIPLK
760 770 780 790 800
GTDLYGNCFK VTSLQSPMGK QTSTWTEKTR IPTEDLHHNL KSKIKECISF
810 820 830 840 850
QSKKTGINWT DDEKRSYKDK GIVQTQEILQ YLLPIVHSTK NMQTTQIKQL
860 870 880 890 900
FNPRTNFQIQ HQLNPATCRN IKKYSTSWTA PRNHPFVIQG DVMANSSEWV
910 920 930 940 950
QSKPHRSLES LSPLKGPKKN KHSQIWAIKN EDIKPLSSKW ETASSSFGMD
960 970 980 990 1000
ANVLKYKSLQ AEETNQQSSK HTALHLTKNK DEQANKNDGQ PTLYLKFQRE

S
Length:1,001
Mass (Da):116,011
Last modified:April 3, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4846AEF2F76336AF
GO
Isoform 2 (identifier: Q8NEM8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-621: SSRGSDSS → RELTFLLR
     622-1001: Missing.

Show »
Length:621
Mass (Da):72,650
Checksum:i37FA956BD0142C8B
GO
Isoform 3 (identifier: Q8NEM8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS
     106-1001: Missing.

Show »
Length:177
Mass (Da):20,403
Checksum:iEC834FFDAF0A5400
GO
Isoform 4 (identifier: Q8NEM8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     704-784: Missing.

Show »
Length:920
Mass (Da):107,047
Checksum:i804684527132B7C8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W7R4F8W7R4_HUMAN
Cytosolic carboxypeptidase 3
AGBL3
704Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W6Y5F8W6Y5_HUMAN
Cytosolic carboxypeptidase 3
AGBL3
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti210F → S in BAH13813 (PubMed:14702039).Curated1
Sequence conflicti396V → A in BAH13813 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03157345F → Y. Corresponds to variant dbSNP:rs2348049Ensembl.1
Natural variantiVAR_031574122E → Q2 PublicationsCorresponds to variant dbSNP:rs4236655Ensembl.1
Natural variantiVAR_031575360T → I. Corresponds to variant dbSNP:rs17804854Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024370105W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. 1 Publication1
Alternative sequenceiVSP_024371106 – 1001Missing in isoform 3. 1 PublicationAdd BLAST896
Alternative sequenceiVSP_024372614 – 621SSRGSDSS → RELTFLLR in isoform 2. 1 Publication8
Alternative sequenceiVSP_024373622 – 1001Missing in isoform 2. 1 PublicationAdd BLAST380
Alternative sequenceiVSP_040423704 – 784Missing in isoform 4. 1 PublicationAdd BLAST81

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK023045 mRNA Translation: BAB14371.1
AK302827 mRNA Translation: BAH13813.1
AC083862 Genomic DNA No translation available.
AC083870 Genomic DNA No translation available.
AC090497 Genomic DNA No translation available.
BC030651 mRNA Translation: AAH30651.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47718.1 [Q8NEM8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_848658.3, NM_178563.3 [Q8NEM8-4]
XP_016867625.1, XM_017012136.1 [Q8NEM8-4]
XP_016867626.1, XM_017012137.1 [Q8NEM8-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000275763; ENSP00000275763; ENSG00000146856 [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856 [Q8NEM8-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
340351

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:340351

UCSC genome browser

More...
UCSCi
uc011kpw.2, human [Q8NEM8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023045 mRNA Translation: BAB14371.1
AK302827 mRNA Translation: BAH13813.1
AC083862 Genomic DNA No translation available.
AC083870 Genomic DNA No translation available.
AC090497 Genomic DNA No translation available.
BC030651 mRNA Translation: AAH30651.1
CCDSiCCDS47718.1 [Q8NEM8-4]
RefSeqiNP_848658.3, NM_178563.3 [Q8NEM8-4]
XP_016867625.1, XM_017012136.1 [Q8NEM8-4]
XP_016867626.1, XM_017012137.1 [Q8NEM8-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi131041, 5 interactors
IntActiQ8NEM8, 1 interactor
STRINGi9606.ENSP00000388275

Protein family/group databases

MEROPSiM14.026

PTM databases

iPTMnetiQ8NEM8
PhosphoSitePlusiQ8NEM8

Genetic variation databases

BioMutaiAGBL3
DMDMi143955274

Proteomic databases

PaxDbiQ8NEM8
PeptideAtlasiQ8NEM8
PRIDEiQ8NEM8
ProteomicsDBi73184 [Q8NEM8-1]
73185 [Q8NEM8-2]
73186 [Q8NEM8-3]
73187 [Q8NEM8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
9809, 60 antibodies

Genome annotation databases

EnsembliENST00000275763; ENSP00000275763; ENSG00000146856 [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856 [Q8NEM8-4]
GeneIDi340351
KEGGihsa:340351
UCSCiuc011kpw.2, human [Q8NEM8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
340351
DisGeNETi340351

GeneCards: human genes, protein and diseases

More...
GeneCardsi
AGBL3
HGNCiHGNC:27981, AGBL3
HPAiENSG00000146856, Low tissue specificity
MIMi617346, gene
neXtProtiNX_Q8NEM8
OpenTargetsiENSG00000146856
PharmGKBiPA142672635
VEuPathDBiHostDB:ENSG00000146856.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1814, Eukaryota
KOG3641, Eukaryota
GeneTreeiENSGT00940000160916
HOGENOMiCLU_318835_0_0_1
InParanoidiQ8NEM8
OMAiNCDNTLM
OrthoDBi481670at2759
PhylomeDBiQ8NEM8
TreeFamiTF313794

Enzyme and pathway databases

PathwayCommonsiQ8NEM8
ReactomeiR-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
340351, 14 hits in 987 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
340351
PharosiQ8NEM8, Tbio

Protein Ontology

More...
PROi
PR:Q8NEM8
RNActiQ8NEM8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146856, Expressed in esophagogastric junction muscularis propria and 124 other tissues
ExpressionAtlasiQ8NEM8, baseline and differential
GenevisibleiQ8NEM8, HS

Family and domain databases

InterProiView protein in InterPro
IPR040626, Pepdidase_M14_N
IPR000834, Peptidase_M14
PfamiView protein in Pfam
PF18027, Pepdidase_M14_N, 1 hit
PF00246, Peptidase_M14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCBPC3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NEM8
Secondary accession number(s): B7Z827, Q9H965
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: April 7, 2021
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again