Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NEM7 (SP20H_HUMAN)

Entry version 143 (02 Dec 2020)
Sequence version 2 (31 May 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Transcription factor SPT20 homolog

Gene

SUPT20H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) activation during gastrulation. Required for down-regulation of E-cadherin during gastrulation by regulating E-cadherin protein level downstream from NCK-interacting kinase (NIK) and independently of the regulation of transcription by FGF signaling and Snail (By similarity). Required for starvation-induced ATG9A trafficking during autophagy.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processAutophagy, Gastrulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NEM7

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3214847, HATs acetylate histones

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor SPT20 homolog
Alternative name(s):
p38-interacting protein
Short name:
p38IP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SUPT20H
Synonyms:C13orf19, FAM48A
ORF Names:FP757
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000102710.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:20596, SUPT20H

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613417, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NEM7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55578

Open Targets

More...OpenTargetsi		ENSG00000102710

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134985241

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NEM7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SUPT20H

Domain mapping of disease mutations (DMDM)

More...DMDMi		334302791

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001870391 – 779Transcription factor SPT20 homologAdd BLAST779

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei296PhosphoserineBy similarity1
Modified residuei494PhosphothreonineCombined sources1
Modified residuei519PhosphoserineCombined sources1
Modified residuei524PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8NEM7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NEM7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NEM7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NEM7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NEM7

PeptideAtlas

More...PeptideAtlasi		Q8NEM7

PRoteomics IDEntifications database

More...PRIDEi		Q8NEM7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		17715
73182 [Q8NEM7-1]
73183 [Q8NEM7-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8NEM7, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NEM7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NEM7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis, moderately in brain and pituitary gland. Expressed in several fetal tissues, including lung, brain, thymus and kidney. Expression is down-regulated in malignant prostate tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000102710, Expressed in kidney and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NEM7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NEM7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000102710, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAPK14.

Interacts with ATG9A.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120729, 38 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-900, SAGA complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8NEM7

Protein interaction database and analysis system

More...IntActi		Q8NEM7, 23 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NEM7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NEM7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi636 – 754Gln-richAdd BLAST119

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SPT20 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00390000013549

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_020200_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NEM7

Identification of Orthologs from Complete Genome Data

More...OMAi		EDYVFEC

Database of Orthologous Groups

More...OrthoDBi		369747at2759

TreeFam database of animal gene trees

More...TreeFami		TF329155

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021950, Spt20

The PANTHER Classification System

More...PANTHERi		PTHR13526, PTHR13526, 2 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12090, Spt20, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NEM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQQALELALD RAEYVIESAR QRPPKRKYLS SGRKSVFQKL YDLYIEECEK 
        60         70         80         90        100
EPEVKKLRRN VNLLEKLVMQ ETLSCLVVNL YPGNEGYSLM LRGKNGSDSE 
       110        120        130        140        150
TIRLPYEEGE LLEYLDAEEL PPILVDLLEK SQVNIFHCGC VIAEIRDYRQ 
       160        170        180        190        200
SSNMKSPGYQ SRHILLRPTM QTLICDVHSI TSDNHKWTQE DKLLLESQLI 
       210        220        230        240        250
LATAEPLCLD PSIAVTCTAN RLLYNKQKMN TRPMKRCFKR YSRSSLNRQQ 
       260        270        280        290        300
DLSHCPPPPQ LRLLDFLQKR KERKAGQHYD LKISKAGNCV DMWKRSPCNL 
       310        320        330        340        350
AIPSEVDVEK YAKVEKSIKS DDSQPTVWPA HDVKDDYVFE CEAGTQYQKT 
       360        370        380        390        400
KLTILQSLGD PLYYGKIQPC KADEESDSQM SPSHSSTDDH SNWFIIGSKT 
       410        420        430        440        450
DAERVVNQYQ ELVQNEAKCP VKMSHSSSGS ASLSQVSPGK ETDQTETVSV 
       460        470        480        490        500
QSSVLGKGVK HRPPPIKLPS SSGNSSSGNY FTPQQTSSFL KSPTPPPSSK 
       510        520        530        540        550
PSSIPRKSSV DLNQVSMLSP AALSPASSSQ RTTATQVMAN SAGLNFINVV 
       560        570        580        590        600
GSVCGAQALM SGSNPMLGCN TGAITPAGIN LSGLLPSGGL LPNALPSAMQ 
       610        620        630        640        650
AASQAGVPFG LKNTSSLRPL NLLQLPGGSL IFNTLQQQQQ QLSQFTPQQP 
       660        670        680        690        700
QQPTTCSPQQ PGEQGSEQGS TSQEQALSAQ QAAVINLTGV GSFMQSQAAV 
       710        720        730        740        750
LSQLGSAENR PEQSLPQQRF QLSSAFQQQQ QQIQQLRFLQ HQMAMAAAAA 
       760        770 
QTAQLHHHRH TGSQSKSKMK RGTPTTPKF
Length:779
Mass (Da):85,789
Last modified:May 31, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CD7DFD8719F621C
GO
Isoform 2 (identifier: Q8NEM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-55: K → KQ
     700-732: VLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQ → AVAILAASNGYGSSSSTNSSATSSSAYRQPVKK
     733-779: Missing.

Show »
Length:733
Mass (Da):80,102
Checksum:i7FC9A980B6FF1935
GO
Isoform 3 (identifier: Q8NEM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     531-531: R → RSGTPKPSTP...STMVTSITPG
     700-732: VLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQ → AVAILAASNGYGSSSSTNSSATSSSAYRQPVKK
     733-779: Missing.

Show »
Length:811
Mass (Da):88,041
Checksum:i110B9040C3B5C8A3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6S7C4F6S7C4_HUMAN
Transcription factor SPT20 homolog
SUPT20H
736Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4E2D5B4E2D5_HUMAN
Transcription factor SPT20 homolog
SUPT20H
498Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5F9H7C5F9_HUMAN
Transcription factor SPT20 homolog
SUPT20H
378Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GND2R4GND2_HUMAN
Transcription factor SPT20 homolog
SUPT20H
522Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQS2C9JQS2_HUMAN
Transcription factor SPT20 homolog
SUPT20H
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ15220 differs from that shown. Intron retention.Curated
The sequence AAQ15220 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti707A → V in AAH30686 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055798154M → V. Corresponds to variant dbSNP:rs7324275Ensembl.1
Natural variantiVAR_055799773T → M1 PublicationCorresponds to variant dbSNP:rs9469Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01487755K → KQ in isoform 2. 2 Publications1
Alternative sequenceiVSP_055621531R → RSGTPKPSTPTPTPSSTPHP PDAQSSTPSTPSATPTPQDS GFTPQPTLLTQFAQQQRSLS QAMPVTTIPLSTMVTSITPG in isoform 3. 1 Publication1
Alternative sequenceiVSP_014878700 – 732VLSQL…QQQQQ → AVAILAASNGYGSSSSTNSS ATSSSAYRQPVKK in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33
Alternative sequenceiVSP_014879733 – 779Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ130894 mRNA Translation: CAB62207.1
AF093250 mRNA Translation: AAD40550.1
AK225376 mRNA No translation available.
AL138706 Genomic DNA No translation available.
AL391383 Genomic DNA No translation available.
BC030686 mRNA Translation: AAH30686.1
AF370384 mRNA Translation: AAQ15220.1 Sequence problems.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31959.1 [Q8NEM7-1]
CCDS61311.1 [Q8NEM7-3]
CCDS9362.1 [Q8NEM7-2]

NCBI Reference Sequences

More...RefSeqi		NP_001014308.2, NM_001014286.2 [Q8NEM7-1]
NP_001265409.1, NM_001278480.1 [Q8NEM7-3]
NP_001265410.1, NM_001278481.1 [Q8NEM7-2]
NP_001265411.1, NM_001278482.1 [Q8NEM7-2]
NP_060039.1, NM_017569.3 [Q8NEM7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000350612; ENSP00000218894; ENSG00000102710 [Q8NEM7-1]
ENST00000356185; ENSP00000348512; ENSG00000102710 [Q8NEM7-2]
ENST00000360252; ENSP00000353388; ENSG00000102710 [Q8NEM7-2]
ENST00000464744; ENSP00000419754; ENSG00000102710 [Q8NEM7-2]
ENST00000475892; ENSP00000417510; ENSG00000102710 [Q8NEM7-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55578

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55578

UCSC genome browser

More...UCSCi		uc001uwg.4, human [Q8NEM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ130894 mRNA Translation: CAB62207.1
AF093250 mRNA Translation: AAD40550.1
AK225376 mRNA No translation available.
AL138706 Genomic DNA No translation available.
AL391383 Genomic DNA No translation available.
BC030686 mRNA Translation: AAH30686.1
AF370384 mRNA Translation: AAQ15220.1 Sequence problems.
CCDSiCCDS31959.1 [Q8NEM7-1]
CCDS61311.1 [Q8NEM7-3]
CCDS9362.1 [Q8NEM7-2]
RefSeqiNP_001014308.2, NM_001014286.2 [Q8NEM7-1]
NP_001265409.1, NM_001278480.1 [Q8NEM7-3]
NP_001265410.1, NM_001278481.1 [Q8NEM7-2]
NP_001265411.1, NM_001278482.1 [Q8NEM7-2]
NP_060039.1, NM_017569.3 [Q8NEM7-2]

3D structure databases

SMRiQ8NEM7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120729, 38 interactors
ComplexPortaliCPX-900, SAGA complex
CORUMiQ8NEM7
IntActiQ8NEM7, 23 interactors

PTM databases

GlyGeniQ8NEM7, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ8NEM7
PhosphoSitePlusiQ8NEM7

Polymorphism and mutation databases

BioMutaiSUPT20H
DMDMi334302791

Proteomic databases

EPDiQ8NEM7
jPOSTiQ8NEM7
MassIVEiQ8NEM7
MaxQBiQ8NEM7
PaxDbiQ8NEM7
PeptideAtlasiQ8NEM7
PRIDEiQ8NEM7
ProteomicsDBi17715
73182 [Q8NEM7-1]
73183 [Q8NEM7-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		49228, 74 antibodies

The DNASU plasmid repository

More...DNASUi		55578

Genome annotation databases

EnsembliENST00000350612; ENSP00000218894; ENSG00000102710 [Q8NEM7-1]
ENST00000356185; ENSP00000348512; ENSG00000102710 [Q8NEM7-2]
ENST00000360252; ENSP00000353388; ENSG00000102710 [Q8NEM7-2]
ENST00000464744; ENSP00000419754; ENSG00000102710 [Q8NEM7-2]
ENST00000475892; ENSP00000417510; ENSG00000102710 [Q8NEM7-3]
GeneIDi55578
KEGGihsa:55578
UCSCiuc001uwg.4, human [Q8NEM7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55578
DisGeNETi55578
EuPathDBiHostDB:ENSG00000102710.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		SUPT20H
HGNCiHGNC:20596, SUPT20H
HPAiENSG00000102710, Low tissue specificity
MIMi613417, gene
neXtProtiNX_Q8NEM7
OpenTargetsiENSG00000102710
PharmGKBiPA134985241

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00390000013549
HOGENOMiCLU_020200_1_0_1
InParanoidiQ8NEM7
OMAiEDYVFEC
OrthoDBi369747at2759
TreeFamiTF329155

Enzyme and pathway databases

PathwayCommonsiQ8NEM7
ReactomeiR-HSA-3214847, HATs acetylate histones

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55578, 103 hits in 857 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SUPT20H, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FAM48A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55578
PharosiQ8NEM7, Tbio

Protein Ontology

More...PROi		PR:Q8NEM7
RNActiQ8NEM7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000102710, Expressed in kidney and 235 other tissues
ExpressionAtlasiQ8NEM7, baseline and differential
GenevisibleiQ8NEM7, HS

Family and domain databases

InterProiView protein in InterPro
IPR021950, Spt20
PANTHERiPTHR13526, PTHR13526, 2 hits
PfamiView protein in Pfam
PF12090, Spt20, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSP20H_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NEM7
Secondary accession number(s): E7ER46, Q71RF3, Q9Y6A6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: May 31, 2011
Last modified: December 2, 2020
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again