UniProtKB - Q8NEM2 (SHCBP_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q8NEM2|SHCBP_HUMAN SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3 MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFM PEGKTFFPEIFQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWH TNVFKVLVEITDVDFAALKAVVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWV VFDDSGVFDQTALAIEHVRFFYQNIWRSWDEEEEDEYDYFVRCVEPRLRLHYDILEDRVP SGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENISMVEGLKLYSEMEQLKQKLK LIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTDRLCQEPGEEE REIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMK NSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNE GYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCA RTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFK WNGKGSFGTFLF
- Align
SHC SH2 domain-binding protein 1
SHCBP1
Annotation score:4 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- SH2 domain binding Source: Ensembl
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- fibroblast growth factor receptor signaling pathway Source: UniProtKB
- regulation of neural precursor cell proliferation Source: UniProtKB
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: SHC SH2 domain-binding protein 1 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:SHCBP1 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000171241.8 |
Human Gene Nomenclature Database More...HGNCi | HGNC:29547 SHCBP1 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 611027 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q8NEM2 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Cytoskeleton
- spindle 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes."
Montembault E., Zhang W., Przewloka M.R., Archambault V., Sevin E.W., Laue E.D., Glover D.M., D'Avino P.P.
J. Cell Biol. 191:1351-1365(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH KIF23 AND RACGAP1, SUBCELLULAR LOCATION.
- spindle 1 Publication
Other locations
- Midbody 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes."
Montembault E., Zhang W., Przewloka M.R., Archambault V., Sevin E.W., Laue E.D., Glover D.M., D'Avino P.P.
J. Cell Biol. 191:1351-1365(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH KIF23 AND RACGAP1, SUBCELLULAR LOCATION.
Note: Displays weak localization to the spindle midzone in some early telophase cells and is concentrated at the midbody in late cytokinesis.1 Publication- Midbody 1 Publication
- Ref.8"Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes."
Montembault E., Zhang W., Przewloka M.R., Archambault V., Sevin E.W., Laue E.D., Glover D.M., D'Avino P.P.
J. Cell Biol. 191:1351-1365(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH KIF23 AND RACGAP1, SUBCELLULAR LOCATION.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cytoplasm, Cytoskeleton<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Organism-specific databases
DisGeNET More...DisGeNETi | 79801 |
Open Targets More...OpenTargetsi | ENSG00000171241 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA134931125 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | SHCBP1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 296452958 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | RemovedCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000076315 | 2 – 672 | SHC SH2 domain-binding protein 1Add BLAST | 671 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 2 | N-acetylalanineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 5 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 7 | PhosphothreonineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 31 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 42 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 44 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 47 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 273 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 634 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Acetylation, PhosphoproteinProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q8NEM2 |
MaxQB - The MaxQuant DataBase More...MaxQBi | Q8NEM2 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q8NEM2 |
PeptideAtlas More...PeptideAtlasi | Q8NEM2 |
PRoteomics IDEntifications database More...PRIDEi | Q8NEM2 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 73181 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q8NEM2 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q8NEM2 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000171241 |
CleanEx database of gene expression profiles More...CleanExi | HS_SHCBP1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q8NEM2 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q8NEM2 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA048876 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
<p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi
1 Publication<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes."
Montembault E., Zhang W., Przewloka M.R., Archambault V., Sevin E.W., Laue E.D., Glover D.M., D'Avino P.P.
J. Cell Biol. 191:1351-1365(2010) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH KIF23 AND RACGAP1, SUBCELLULAR LOCATION.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PRKCB | P05771 | 2 | EBI-744700,EBI-706216 | |
| YWHAG | P61981 | 2 | EBI-744700,EBI-359832 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- SH2 domain binding Source: Ensembl
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 122898, 36 interactors |
CORUM comprehensive resource of mammalian protein complexes More...CORUMi | Q8NEM2 |
Protein interaction database and analysis system More...IntActi | Q8NEM2, 15 interactors |
Molecular INTeraction database More...MINTi | Q8NEM2 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000306473 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q8NEM2 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q8NEM2 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 428 – 451 | PbH1 1Add BLAST | 24 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 452 – 473 | PbH1 2Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 474 – 496 | PbH1 3Add BLAST | 23 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 497 – 518 | PbH1 4Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 526 – 548 | PbH1 5Add BLAST | 23 |
Compositional bias
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi | 211 – 216 | Poly-Glu | 6 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
RepeatPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IIV2 Eukaryota ENOG410XXTE LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000063807 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000154313 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG060212 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q8NEM2 |
Identification of Orthologs from Complete Genome Data More...OMAi | LMCLHLR |
Database of Orthologous Groups More...OrthoDBi | EOG091G0UP6 |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q8NEM2 |
TreeFam database of animal gene trees More...TreeFami | TF329196 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.160.20.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR006626 PbH1 IPR012334 Pectin_lyas_fold IPR011050 Pectin_lyase_fold/virulence |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00710 PbH1, 5 hits |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF51126 SSF51126, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
10 20 30 40 50
MADGSLTGGG LEAAAMAPER MGWAVEQELA SLEKGLFQDE DSCSDCSYRD
60 70 80 90 100
KPGSSLQSFM PEGKTFFPEI FQTNQLLFYE RFRAYQDYIL ADCKASEVQE
110 120 130 140 150
FTAEFLEKVL EPSGWRAVWH TNVFKVLVEI TDVDFAALKA VVRLAEPYLC
160 170 180 190 200
DSQVSTFTME CMKELLDLKE HRLPLQELWV VFDDSGVFDQ TALAIEHVRF
210 220 230 240 250
FYQNIWRSWD EEEEDEYDYF VRCVEPRLRL HYDILEDRVP SGLIVDYHNL
260 270 280 290 300
LSQCEESYRK FLNLRSSLSN CNSDSEQENI SMVEGLKLYS EMEQLKQKLK
310 320 330 340 350
LIENPLLRYV FGYQKNSNIQ AKGVRSSGQK ITHVVSSTMM AGLLRSLLTD
360 370 380 390 400
RLCQEPGEEE REIQFHSDPL SAINACFEGD TVIVCPGHYV VHGTFSIADS
410 420 430 440 450
IELEGYGLPD DIVIEKRGKG DTFVDCTGAD IKISGIKFVQ HDAVEGILIV
460 470 480 490 500
HRGKTTLENC VLQCETTGVT VRTSAEFLMK NSDLYGAKGA GIEIYPGSQC
510 520 530 540 550
TLSDNGIHHC KEGILIKDFL DEHYDIPKIS MVNNIIHNNE GYGVVLVKPT
560 570 580 590 600
IFSDLQENAE DGTEENKALK IQTSGEPDVA ERVDLEELIE CATGKMELCA
610 620 630 640 650
RTDPSEQVEG NCEIVNELIA ASTQKGQIKK KRLSELGITQ ADDNLMSQEM
660 670
FVGIVGNQFK WNGKGSFGTF LF
<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 118 | V → A in BAB71049 (PubMed:14702039).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 329 | Q → R in BAB71049 (PubMed:14702039).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 437 | K → R in BAB15208 (PubMed:14702039).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 450 | V → A in BAB15208 (PubMed:14702039).Curated | 1 | |
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 558 | N → S in AAH30699 (PubMed:15489334).Curated | 1 |
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051354 | 21 | M → TCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051355 | 60 | M → R. Corresponds to variant dbSNP:rs11545690Ensembl. | 1 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AK025662 mRNA Translation: BAB15208.1 Different initiation. AK055931 mRNA Translation: BAB71049.1 AC092368 Genomic DNA No translation available. BC000960 mRNA Translation: AAH00960.1 BC030699 mRNA Translation: AAH30699.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS10720.1 |
NCBI Reference Sequences More...RefSeqi | NP_079021.3, NM_024745.4 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.123253 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000303383; ENSP00000306473; ENSG00000171241 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 79801 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:79801 |
UCSC genome browser More...UCSCi | uc002eec.5 human |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q8NEM2 | Uncharacterized protein | 712 | |||
| SHC SH2 domain-binding protein 1 | 674 | ||||
| UPI0002BD17CC | 674 | ||||
| UPI000441DFF4 | 674 | ||||
| UPI000A1BEE60 | 674 | ||||
| +40 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q8NEM2 | Uncharacterized protein | 712 | |||
| UPI0002BD17CC | 674 | ||||
| UPI0003C8A933 | 674 | ||||
| UPI0005770B18 | 674 | ||||
| UPI000A1BEE60 | 674 | ||||
| +56 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AK025662 mRNA Translation: BAB15208.1 Different initiation. AK055931 mRNA Translation: BAB71049.1 AC092368 Genomic DNA No translation available. BC000960 mRNA Translation: AAH00960.1 BC030699 mRNA Translation: AAH30699.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS10720.1 |
NCBI Reference Sequences More...RefSeqi | NP_079021.3, NM_024745.4 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.123253 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q8NEM2 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q8NEM2 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 122898, 36 interactors |
CORUM comprehensive resource of mammalian protein complexes More...CORUMi | Q8NEM2 |
Protein interaction database and analysis system More...IntActi | Q8NEM2, 15 interactors |
Molecular INTeraction database More...MINTi | Q8NEM2 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000306473 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q8NEM2 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q8NEM2 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | SHCBP1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 296452958 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q8NEM2 |
MaxQB - The MaxQuant DataBase More...MaxQBi | Q8NEM2 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q8NEM2 |
PeptideAtlas More...PeptideAtlasi | Q8NEM2 |
PRoteomics IDEntifications database More...PRIDEi | Q8NEM2 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 73181 |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 79801 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000303383; ENSP00000306473; ENSG00000171241 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 79801 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:79801 |
UCSC genome browser More...UCSCi | uc002eec.5 human |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 79801 |
DisGeNET More...DisGeNETi | 79801 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000171241.8 |
GeneCards: human genes, protein and diseases More...GeneCardsi | SHCBP1 |
Human Gene Nomenclature Database More...HGNCi | HGNC:29547 SHCBP1 |
Human Protein Atlas More...HPAi | HPA048876 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 611027 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q8NEM2 |
Open Targets More...OpenTargetsi | ENSG00000171241 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA134931125 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG410IIV2 Eukaryota ENOG410XXTE LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00530000063807 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000154313 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG060212 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q8NEM2 |
Identification of Orthologs from Complete Genome Data More...OMAi | LMCLHLR |
Database of Orthologous Groups More...OrthoDBi | EOG091G0UP6 |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q8NEM2 |
TreeFam database of animal gene trees More...TreeFami | TF329196 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | SHCBP1 human |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | SHCBP1 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 79801 |
Protein Ontology More...PROi | PR:Q8NEM2 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000171241 |
CleanEx database of gene expression profiles More...CleanExi | HS_SHCBP1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q8NEM2 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q8NEM2 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 2.160.20.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR006626 PbH1 IPR012334 Pectin_lyas_fold IPR011050 Pectin_lyase_fold/virulence |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00710 PbH1, 5 hits |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF51126 SSF51126, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | SHCBP_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q8NEM2Primary (citable) accession number: Q8NEM2 Secondary accession number(s): Q96N60, Q9BVS0, Q9H6P6 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | December 20, 2005 |
| Last sequence update: | May 18, 2010 | |
| Last modified: | July 18, 2018 | |
| This is version 133 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
