Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Oct 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium uniporter protein, mitochondrial

Gene

MCU

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria (PubMed:21685888, PubMed:21685886, PubMed:23101630, PubMed:22904319, PubMed:23178883, PubMed:22829870, PubMed:22822213, PubMed:24332854, PubMed:23755363, PubMed:26341627). Constitutes the pore-forming and calcium-conducting subunit of the uniporter complex (uniplex) (PubMed:23755363). Activity is regulated by MICU1 and MICU2. At low Ca2+ levels MCU activity is down-regulated by MICU1 and MICU2; at higher Ca2+ levels MICU1 increases MCU activity (PubMed:24560927, PubMed:26903221). Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes (PubMed:22822213). While dispensable for baseline homeostatic cardiac function, acts as a key regulator of short-term mitochondrial calcium loading underlying a 'fight-or-flight' response during acute stress: acts by mediating a rapid increase of mitochondrial calcium in pacemaker cells (PubMed:25603276). participates in mitochondrial permeability transition during ischemia-reperfusion injury (By similarity). Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake (PubMed:22904319, PubMed:22829870). Mitochondrial calcium uptake in skeletal muscle cells is involved in muscle size in adults (By similarity). Regulates synaptic vesicle endocytosis kinetics in central nerve terminal (By similarity). Involved in antigen processing and presentation (By similarity).By similarity13 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by ruthenium red or its derivative Ru360.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8949215 Mitochondrial calcium ion transport
R-HSA-8949664 Processing of SMDT1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium uniporter protein, mitochondrial1 Publication
Short name:
HsMCU1 Publication
Alternative name(s):
Coiled-coil domain-containing protein 109ACurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MCU1 PublicationImported
Synonyms:C10orf42Imported, CCDC109AImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23526 MCU

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614197 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NE86

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini51 – 233Mitochondrial matrix1 PublicationAdd BLAST183
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei234 – 256HelicalSequence analysisAdd BLAST23
Topological domaini257 – 265Mitochondrial intermembrane1 Publication9
Transmembranei266 – 283HelicalSequence analysisAdd BLAST18
Topological domaini284 – 351Mitochondrial matrix1 Publication1 PublicationAdd BLAST68

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi57S → A: Decreased MCU current; when associated with A-92. 1 Publication1
Mutagenesisi92S → A: Decreased MCU current; when associated with A-57. 1 Publication1
Mutagenesisi92S → A: Impairs Ca(2+) uptake, but has no effect on oligomerization and interaction with MCU1 and MCU2. 1 Publication1
Mutagenesisi180K → A: No effect on Ca(2+) uptake, oligomerization and interaction with MCU1 and MCU2. 1 Publication1
Mutagenesisi257E → A: According to a report, inhibits calcium uptake. According to a subsequent report, does not affect greatly calcium uptake. 2 Publications1
Mutagenesisi257E → S: Does not affect greatly calcium uptake. 1 Publication1
Mutagenesisi259S → A: Does not inhibit calcium uptake. Strongly reduced sensitivity to ruthenium red inhibition. 2 Publications1
Mutagenesisi259S → R: Prevents entrance of calcium into the pore. 1 Publication1
Mutagenesisi261 – 264DIME → AIMA: Dominant negative (DN) mutant; inhibits calcium uptake. Inhibits calcium channel activity. Expression of the dominant negative protein in mice, leads to mice that are incapable of physiological fight or flight heart rate acceleration. 3 Publications4
Mutagenesisi261D → E: Partially functional; does not completely abolish calcium channel activity. 1 Publication1
Mutagenesisi264E → D: Abolishes calcium channel activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
90550

Open Targets

More...
OpenTargetsi
ENSG00000156026

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134888841

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NE86

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MCU

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730222

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 50MitochondrionSequence analysisAdd BLAST50
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000028297651 – 351Calcium uniporter protein, mitochondrialAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei57Phosphoserine; by CaMK21 Publication1
Modified residuei92Phosphoserine; by CaMK21 Publication1
Modified residuei332N6-acetyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by CaMK2 in heart leads to increased MCU current (PubMed:23051746, PubMed:25254481). The regulation of MCU by CaMK2 is however subject to discussion: another group was unable to reproduce these results (PubMed:25254480). Phosphorylated on tyrosines by PTK2B/PYK2, promoting oligomerization (PubMed:24800979).3 Publications1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NE86

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NE86

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NE86

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NE86

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NE86

PeptideAtlas

More...
PeptideAtlasi
Q8NE86

PRoteomics IDEntifications database

More...
PRIDEi
Q8NE86

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
73134 [Q8NE86-1]
73135 [Q8NE86-2]
73136 [Q8NE86-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8NE86-3 [Q8NE86-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NE86

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NE86

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8NE86

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

MCU transcripts are down-regulated by microRNA miR-25 (PubMed:23246404). Down-regulation by miR-25 may protect cardiomyocytes against oxidative damage in cardiomyocytes (PubMed:25764156).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156026 Expressed in 175 organ(s), highest expression level in cerebellar hemisphere

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NE86 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NE86 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016480

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the uniplex complex, composed of MCU, MCUB, MICU1, MICU2 and EMRE/SMDT1 (PubMed:24231807). Homooligomer (PubMed:21685886, PubMed:26341627).

Forms a pentamer (By similarity). Heterooligomer with CCDC109B/MCUB; this inhibits channel activity (By similarity).

Interacts with MICU1; MICU1 acts as an essential regulator for MCU (PubMed:21685886, PubMed:23101630, PubMed:23178883, PubMed:24332854, PubMed:26341627).

Interacts with MCUR1 (PubMed:23178883, PubMed:26341627, PubMed:27184846, PubMed:26976564).

Interacts with CCDC90B (PubMed:27184846). Interactions with MICU1 and MCUR1 are mutually exclusive (PubMed:23178883).

Interacts with MICU2 (PubMed:26341627).

Interacts with SLC25A23 (PubMed:24430870).

By similarity9 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124733, 43 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8NE86

Database of interacting proteins

More...
DIPi
DIP-60468N

Protein interaction database and analysis system

More...
IntActi
Q8NE86, 26 interactors

Molecular INTeraction database

More...
MINTi
Q8NE86

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362144

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1351
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NE86

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni75 – 165N-terminal MCU domain1 PublicationAdd BLAST91
Regioni216 – 234Outer juxtamembrane helix (OJMH)By similarityAdd BLAST19
Regioni283 – 292Inner juxtamembrane helix (IJMH)By similarity10

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili192 – 223Sequence analysisAdd BLAST32
Coiled coili311 – 339Sequence analysisAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi261 – 264DXXEBy similarity4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal MCU domain is required for efficient Ca2+ uptake and for interaction with MCUR1. It is not required for targeting to the mitochondria, oligomerization, interaction with MICU1 and MICU2, or assembly of the uniplex complex.1 Publication
Forms a well-packed pentamer with an overall cylindrical shape. The inner core of the pentamer is formed with the second transmembrane region and the second coiled-coil region: while the transmembrane regions pack into a five-helix bundle having a largely polar pore across the membrane, the coiled-coil outside the membrane forms a pentamer with a hydrophobic core. The inner core is wrapped by the first transmembrane region through contacts between the first and the second transmembrane regions. The second transmembrane is followed by the inner juxtamembrane region (IJMH) that orients at a wide angle relative to the second transmembrane. The two core domains are held together on the periphery by the outer juxtamembrane helix (OJMH).By similarity
The critical DXXE motif connecting the transmembrane regions forms a pentameric barrel that constitutes the mouth of the pore. Inside the barrel, two acidic residues are in position to form two carboxylate rings. In absence of SMDT1/EMRE regulator, the calcium ions cannot exit the channel, suggesting that SMDT1/EMRE-binding induces conformational rearrangements to allow calcium to exit.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2966 Eukaryota
ENOG410Y3YU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157528

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008081

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NE86

KEGG Orthology (KO)

More...
KOi
K20858

Identification of Orthologs from Complete Genome Data

More...
OMAi
CIEEHQL

Database of Orthologous Groups

More...
OrthoDBi
1076768at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NE86

TreeFam database of animal gene trees

More...
TreeFami
TF314435

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006769 MCU_C
IPR039055 MCU_fam

The PANTHER Classification System

More...
PANTHERi
PTHR13462 PTHR13462, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04678 MCU, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NE86-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAGRSLL LLLSSRGGGG GGAGGCGALT AGCFPGLGVS RHRQQQHHRT
60 70 80 90 100
VHQRIASWQN LGAVYCSTVV PSDDVTVVYQ NGLPVISVRL PSRRERCQFT
110 120 130 140 150
LKPISDSVGV FLRQLQEEDR GIDRVAIYSP DGVRVAASTG IDLLLLDDFK
160 170 180 190 200
LVINDLTYHV RPPKRDLLSH ENAATLNDVK TLVQQLYTTL CIEQHQLNKE
210 220 230 240 250
RELIERLEDL KEQLAPLEKV RIEISRKAEK RTTLVLWGGL AYMATQFGIL
260 270 280 290 300
ARLTWWEYSW DIMEPVTYFI TYGSAMAMYA YFVMTRQEYV YPEARDRQYL
310 320 330 340 350
LFFHKGAKKS RFDLEKYNQL KDAIAQAEMD LKRLRDPLQV HLPLRQIGEK

D
Length:351
Mass (Da):39,867
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i50205D01055D66E4
GO
Isoform 2 (identifier: Q8NE86-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-219: DLLSHENAAT...LKEQLAPLEK → VEMGFCHVGQNGFELLTSSYLPASASQSAEIIA

Note: No experimental confirmation available.
Show »
Length:330
Mass (Da):36,996
Checksum:i56D458541240604A
GO
Isoform 3 (identifier: Q8NE86-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRT → M

Show »
Length:302
Mass (Da):35,159
Checksum:i65C6D99CD9D2D3FC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R468S4R468_HUMAN
Calcium uniporter protein, mitochon...
MCU
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3W8S4R3W8_HUMAN
Calcium uniporter protein, mitochon...
MCU
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R319S4R319_HUMAN
Calcium uniporter protein, mitochon...
MCU
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3F5S4R3F5_HUMAN
Calcium uniporter protein, mitochon...
MCU
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R332S4R332_HUMAN
Calcium uniporter protein, mitochon...
MCU
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti107S → P in BAG37900 (PubMed:14702039).Curated1
Sequence conflicti142D → Y in BAG37900 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0416871 – 50MAAAA…QHHRT → M in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_024263166 – 219DLLSH…APLEK → VEMGFCHVGQNGFELLTSSY LPASASQSAEIIA in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK315519 mRNA Translation: BAG37900.1
AK128016 mRNA Translation: BAG54619.1
AC016542 Genomic DNA No translation available.
AC069548 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54461.1
BC010682 mRNA Translation: AAH10682.1
BC034235 mRNA Translation: AAH34235.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS59218.1 [Q8NE86-2]
CCDS59219.1 [Q8NE86-3]
CCDS7317.1 [Q8NE86-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001257608.1, NM_001270679.1 [Q8NE86-2]
NP_001257609.1, NM_001270680.1 [Q8NE86-3]
NP_612366.1, NM_138357.2 [Q8NE86-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000357157; ENSP00000349680; ENSG00000156026 [Q8NE86-2]
ENST00000373053; ENSP00000362144; ENSG00000156026 [Q8NE86-1]
ENST00000536019; ENSP00000440913; ENSG00000156026 [Q8NE86-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90550

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90550

UCSC genome browser

More...
UCSCi
uc001jtc.3 human [Q8NE86-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK315519 mRNA Translation: BAG37900.1
AK128016 mRNA Translation: BAG54619.1
AC016542 Genomic DNA No translation available.
AC069548 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54461.1
BC010682 mRNA Translation: AAH10682.1
BC034235 mRNA Translation: AAH34235.1
CCDSiCCDS59218.1 [Q8NE86-2]
CCDS59219.1 [Q8NE86-3]
CCDS7317.1 [Q8NE86-1]
RefSeqiNP_001257608.1, NM_001270679.1 [Q8NE86-2]
NP_001257609.1, NM_001270680.1 [Q8NE86-3]
NP_612366.1, NM_138357.2 [Q8NE86-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4XSJX-ray1.80A75-165[»]
4XTBX-ray1.50A75-185[»]
5BZ6X-ray2.75A75-165[»]
5KUEX-ray1.50A72-189[»]
5KUGX-ray1.90A72-189[»]
5KUIX-ray2.70A72-189[»]
5KUJX-ray1.60A72-189[»]
6O58electron microscopy3.80A/C/E/G/I/K/M/O1-351[»]
6O5Belectron microscopy3.60A/C/E/G/I/J/K/L1-351[»]
SMRiQ8NE86
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi124733, 43 interactors
CORUMiQ8NE86
DIPiDIP-60468N
IntActiQ8NE86, 26 interactors
MINTiQ8NE86
STRINGi9606.ENSP00000362144

PTM databases

iPTMnetiQ8NE86
PhosphoSitePlusiQ8NE86
SwissPalmiQ8NE86

Polymorphism and mutation databases

BioMutaiMCU
DMDMi74730222

Proteomic databases

EPDiQ8NE86
jPOSTiQ8NE86
MassIVEiQ8NE86
MaxQBiQ8NE86
PaxDbiQ8NE86
PeptideAtlasiQ8NE86
PRIDEiQ8NE86
ProteomicsDBi73134 [Q8NE86-1]
73135 [Q8NE86-2]
73136 [Q8NE86-3]
TopDownProteomicsiQ8NE86-3 [Q8NE86-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
90550

Genome annotation databases

EnsembliENST00000357157; ENSP00000349680; ENSG00000156026 [Q8NE86-2]
ENST00000373053; ENSP00000362144; ENSG00000156026 [Q8NE86-1]
ENST00000536019; ENSP00000440913; ENSG00000156026 [Q8NE86-3]
GeneIDi90550
KEGGihsa:90550
UCSCiuc001jtc.3 human [Q8NE86-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90550
DisGeNETi90550

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MCU
HGNCiHGNC:23526 MCU
HPAiHPA016480
MIMi614197 gene
neXtProtiNX_Q8NE86
OpenTargetsiENSG00000156026
PharmGKBiPA134888841

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2966 Eukaryota
ENOG410Y3YU LUCA
GeneTreeiENSGT00940000157528
HOGENOMiHOG000008081
InParanoidiQ8NE86
KOiK20858
OMAiCIEEHQL
OrthoDBi1076768at2759
PhylomeDBiQ8NE86
TreeFamiTF314435

Enzyme and pathway databases

ReactomeiR-HSA-8949215 Mitochondrial calcium ion transport
R-HSA-8949664 Processing of SMDT1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MCU human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90550
PharosiQ8NE86

Protein Ontology

More...
PROi
PR:Q8NE86

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000156026 Expressed in 175 organ(s), highest expression level in cerebellar hemisphere
ExpressionAtlasiQ8NE86 baseline and differential
GenevisibleiQ8NE86 HS

Family and domain databases

InterProiView protein in InterPro
IPR006769 MCU_C
IPR039055 MCU_fam
PANTHERiPTHR13462 PTHR13462, 1 hit
PfamiView protein in Pfam
PF04678 MCU, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMCU_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NE86
Secondary accession number(s): B2RDF3, B3KXV7, Q96FL3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2002
Last modified: October 16, 2019
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again