Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (22 Apr 2020)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Metal transporter CNNM3

Gene

CNNM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable metal transporter.By similarity

Miscellaneous

Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.112.1.3 the cyclin m mg2+ exporter (cnnm) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Metal transporter CNNM3
Alternative name(s):
Ancient conserved domain-containing protein 3
Cyclin-M3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CNNM3
Synonyms:ACDP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:104 CNNM3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607804 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NE01

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei11 – 27HelicalSequence analysisAdd BLAST17
Transmembranei193 – 213HelicalSequence analysisAdd BLAST21
Transmembranei221 – 241HelicalSequence analysisAdd BLAST21
Transmembranei261 – 281HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26505

Open Targets

More...
OpenTargetsi
ENSG00000168763

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26670

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NE01 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CNNM3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751242

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002957631 – 707Metal transporter CNNM3Add BLAST707

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei661PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NE01

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NE01

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NE01

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NE01

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NE01

PeptideAtlas

More...
PeptideAtlasi
Q8NE01

PRoteomics IDEntifications database

More...
PRIDEi
Q8NE01

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
73108 [Q8NE01-1]
73109 [Q8NE01-2]
73110 [Q8NE01-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8NE01-1 [Q8NE01-1]
Q8NE01-2 [Q8NE01-2]
Q8NE01-3 [Q8NE01-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NE01

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NE01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at higher level in heart and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168763 Expressed in muscle of leg and 196 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NE01 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000168763 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q8NE01
With#Exp.IntAct
ACTN2 [P35609]3EBI-741032,EBI-77797
AGR2 [O95994]3EBI-741032,EBI-712648
AGR3 [Q8TD06]3EBI-741032,EBI-3925742
AKAP8L [Q9ULX6]3EBI-741032,EBI-357530
CALCOCO2 [Q13137]3EBI-741032,EBI-739580
CARD10 [Q9BWT7]3EBI-741032,EBI-3866279
CCNDBP1 [O95273]3EBI-741032,EBI-748961
COG6 [Q9Y2V7]3EBI-741032,EBI-3866319
CYSRT1 [A8MQ03]3EBI-741032,EBI-3867333
EFEMP2 [O95967]3EBI-741032,EBI-743414
EXOSC8 [Q96B26]3EBI-741032,EBI-371922
FHL3 [Q13643]9EBI-741032,EBI-741101
FHL5 [Q5TD97]3EBI-741032,EBI-750641
GOLGA6L9 [A6NEM1]3EBI-741032,EBI-5916454
HNRNPK - isoform 2 [P61978-2]3EBI-741032,EBI-7060731
HOXA1 [P49639]5EBI-741032,EBI-740785
HSF2BP [O75031]3EBI-741032,EBI-7116203
KHDRBS2 [Q5VWX1]3EBI-741032,EBI-742808
KHDRBS3 [O75525]3EBI-741032,EBI-722504
KPRP [Q5T749]3EBI-741032,EBI-10981970
KRT31 [Q15323]3EBI-741032,EBI-948001
KRT33B [Q14525]3EBI-741032,EBI-1049638
KRT40 [Q6A162]3EBI-741032,EBI-10171697
KRTAP1-1 [Q07627]3EBI-741032,EBI-11959885
KRTAP10-5 [P60370]3EBI-741032,EBI-10172150
KRTAP10-7 [P60409]5EBI-741032,EBI-10172290
KRTAP10-8 [P60410]6EBI-741032,EBI-10171774
KRTAP10-9 [P60411]6EBI-741032,EBI-10172052
KRTAP12-2 [P59991]3EBI-741032,EBI-10176379
KRTAP12-3 [P60328]3EBI-741032,EBI-11953334
KRTAP17-1 [Q9BYP8]5EBI-741032,EBI-11988175
KRTAP2-3 [P0C7H8]3EBI-741032,EBI-10196781
KRTAP3-1 [Q9BYR8]3EBI-741032,EBI-9996449
KRTAP3-2 [Q9BYR7]3EBI-741032,EBI-751260
KRTAP5-9 [P26371]6EBI-741032,EBI-3958099
KRTAP9-2 [Q9BYQ4]3EBI-741032,EBI-1044640
KRTAP9-3 [Q9BYQ3]3EBI-741032,EBI-1043191
KRTAP9-8 [Q9BYQ0]3EBI-741032,EBI-11958364
LZTS2 [Q9BRK4]3EBI-741032,EBI-741037
MDFI [Q99750]6EBI-741032,EBI-724076
MID2 - isoform 2 [Q9UJV3-2]3EBI-741032,EBI-10172526
MTUS2 - isoform 2 [Q5JR59-3]3EBI-741032,EBI-11522433
NOTCH2NLC [P0DPK4]3EBI-741032,EBI-22310682
P4HB [P07237]3EBI-741032,EBI-395883
PM20D2 [Q8IYS1]3EBI-741032,EBI-11339910
PNMA1 [Q8ND90]3EBI-741032,EBI-302345
PNMA2 [Q9UL42]3EBI-741032,EBI-302355
PNMA3 [Q9UL41]3EBI-741032,EBI-11278955
RBMX [P38159]3EBI-741032,EBI-743526
RBMY1J [Q15415]3EBI-741032,EBI-8642021
RBPMS - isoform C [Q93062-3]3EBI-741032,EBI-740343
SPERT [Q8NA61]3EBI-741032,EBI-741724
SPERT - isoform 2 [Q8NA61-2]3EBI-741032,EBI-11524851
SRSF3 [P84103]3EBI-741032,EBI-372557
TGM1 [P22735]3EBI-741032,EBI-2562368
TNS2 [Q63HR2]3EBI-741032,EBI-949753
TRIM27 [P14373]3EBI-741032,EBI-719493
UBQLN2 [Q9UHD9]3EBI-741032,EBI-947187
USHBP1 [Q8N6Y0]3EBI-741032,EBI-739895
VWC2 [Q2TAL6]5EBI-741032,EBI-11957238
WWOX - isoform 5 [Q9NZC7-5]3EBI-741032,EBI-12040603
ZNF330 [Q9Y3S2]3EBI-741032,EBI-373456
ZRANB1 [Q9UGI0]3EBI-741032,EBI-527853
Isoform 3 [Q8NE01-3]
With#Exp.IntAct
FHL3 [Q13643]3EBI-10269984,EBI-741101
KRTAP10-9 [P60411]3EBI-10269984,EBI-10172052
KRTAP3-2 [Q9BYR7]3EBI-10269984,EBI-751260
LZTS2 [Q9BRK4]3EBI-10269984,EBI-741037
PNMA1 [Q8ND90]3EBI-10269984,EBI-302345
USHBP1 [Q8N6Y0]3EBI-10269984,EBI-739895

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117712, 36 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NE01, 74 interactors

Molecular INTeraction database

More...
MINTi
Q8NE01

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000305449

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NE01 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1707
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NE01

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini130 – 308CNNM transmembranePROSITE-ProRule annotationAdd BLAST179
Domaini318 – 379CBS 1PROSITE-ProRule annotationAdd BLAST62
Domaini386 – 452CBS 2PROSITE-ProRule annotationAdd BLAST67

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ACDP family.Curated

Keywords - Domaini

CBS domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2118 Eukaryota
COG1253 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161102

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_011310_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NE01

KEGG Orthology (KO)

More...
KOi
K16302

Identification of Orthologs from Complete Genome Data

More...
OMAi
DPYNEFV

Database of Orthologous Groups

More...
OrthoDBi
1446644at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NE01

TreeFam database of animal gene trees

More...
TreeFami
TF101012

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000644 CBS_dom
IPR002550 CNNM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00571 CBS, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51371 CBS, 2 hits
PS51846 CNNM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8NE01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAVAAAGR LGWLFAALCL GNAAGEAAPG PRVLGFCLEE DGAAGAGWVR
60 70 80 90 100
GGAARDTPDA TFLLRLFGPG FANSSWSWVA PEGAGCREEA ASPAGEWRAL
110 120 130 140 150
LRLRLRAEAV RPHSALLAVR VEPGGGAAEE AAPPWALGLG AAGLLALAAL
160 170 180 190 200
ARGLQLSALA LAPAEVQVLR ESGSEAERAA ARRLEPARRW AGCALGALLL
210 220 230 240 250
LASLAQAALA VLLYRAAGQR AVPAVLGSAG LVFLVGEVVP AAVSGRWTLA
260 270 280 290 300
LAPRALGLSR LAVLLTLPVA LPVGQLLELA ARPGRLRERV LELARGGGDP
310 320 330 340 350
YSDLSKGVLR CRTVEDVLTP LEDCFMLDAS TVLDFGVLAS IMQSGHTRIP
360 370 380 390 400
VYEEERSNIV DMLYLKDLAF VDPEDCTPLS TITRFYNHPL HFVFNDTKLD
410 420 430 440 450
AVLEEFKRGK SHLAIVQKVN NEGEGDPFYE VLGLVTLEDV IEEIIRSEIL
460 470 480 490 500
DESEDYRDTV VKRKPASLMA PLKRKEEFSL FKVSDDEYKV TISPQLLLAT
510 520 530 540 550
QRFLSREVDV FSPLRISEKV LLHLLKHPSV NQEVRFDESN RLATHHYLYQ
560 570 580 590 600
RSQPVDYFIL ILQGRVEVEI GKEGLKFENG AFTYYGVSAL TVPSSVHQSP
610 620 630 640 650
VSSLQPIRHD LQPDPGDGTH SSAYCPDYTV RALSDLQLIK VTRLQYLNAL
660 670 680 690 700
LATRAQNLPQ SPENTDLQVI PGSQTRLLGE KTTTAAGSSH SRPGVPVEGS

PGRNPGV
Length:707
Mass (Da):76,119
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i22BE4A950A8DA7F5
GO
Isoform 2 (identifier: Q8NE01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.

Show »
Length:659
Mass (Da):70,632
Checksum:iD5D6950DBB25517B
GO
Isoform 3 (identifier: Q8NE01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.
     694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP

Show »
Length:680
Mass (Da):73,057
Checksum:i96670B9CE30C8E47
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF86377 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH07199 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA90891 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti315E → Q in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti404E → Q in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti407K → M in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti482K → T in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti532Q → H in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti533E → A in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti543A → V in BAA90891 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027082410 – 457Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_027083694 – 707GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK000025 mRNA Translation: BAA90891.1 Frameshift.
AK126847 mRNA Translation: BAG54379.1
AC092636 Genomic DNA Translation: AAY14964.1
BC007199 mRNA Translation: AAH07199.3 Different initiation.
BC022944 mRNA Translation: AAH22944.1
BC037272 mRNA Translation: AAH37272.1
AF216965 mRNA Translation: AAF86377.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2025.1 [Q8NE01-1]
CCDS2026.1 [Q8NE01-2]

NCBI Reference Sequences

More...
RefSeqi
NP_060093.3, NM_017623.4 [Q8NE01-1]
NP_951060.1, NM_199078.2 [Q8NE01-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000305510; ENSP00000305449; ENSG00000168763 [Q8NE01-1]
ENST00000377060; ENSP00000366260; ENSG00000168763 [Q8NE01-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26505

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26505

UCSC genome browser

More...
UCSCi
uc002swy.4 human [Q8NE01-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000025 mRNA Translation: BAA90891.1 Frameshift.
AK126847 mRNA Translation: BAG54379.1
AC092636 Genomic DNA Translation: AAY14964.1
BC007199 mRNA Translation: AAH07199.3 Different initiation.
BC022944 mRNA Translation: AAH22944.1
BC037272 mRNA Translation: AAH37272.1
AF216965 mRNA Translation: AAF86377.1 Different initiation.
CCDSiCCDS2025.1 [Q8NE01-1]
CCDS2026.1 [Q8NE01-2]
RefSeqiNP_060093.3, NM_017623.4 [Q8NE01-1]
NP_951060.1, NM_199078.2 [Q8NE01-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5K22X-ray3.00B309-452[»]
5K23X-ray2.96C309-452[»]
5K25X-ray3.05C309-452[»]
5TSRX-ray3.19B/D309-452[»]
6DFDX-ray1.90A/B453-707[»]
6MN6X-ray3.36A/B299-658[»]
SMRiQ8NE01
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi117712, 36 interactors
IntActiQ8NE01, 74 interactors
MINTiQ8NE01
STRINGi9606.ENSP00000305449

Protein family/group databases

TCDBi1.A.112.1.3 the cyclin m mg2+ exporter (cnnm) family

PTM databases

iPTMnetiQ8NE01
PhosphoSitePlusiQ8NE01

Polymorphism and mutation databases

BioMutaiCNNM3
DMDMi74751242

Proteomic databases

EPDiQ8NE01
jPOSTiQ8NE01
MassIVEiQ8NE01
MaxQBiQ8NE01
PaxDbiQ8NE01
PeptideAtlasiQ8NE01
PRIDEiQ8NE01
ProteomicsDBi73108 [Q8NE01-1]
73109 [Q8NE01-2]
73110 [Q8NE01-3]
TopDownProteomicsiQ8NE01-1 [Q8NE01-1]
Q8NE01-2 [Q8NE01-2]
Q8NE01-3 [Q8NE01-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3096 191 antibodies

The DNASU plasmid repository

More...
DNASUi
26505

Genome annotation databases

EnsembliENST00000305510; ENSP00000305449; ENSG00000168763 [Q8NE01-1]
ENST00000377060; ENSP00000366260; ENSG00000168763 [Q8NE01-2]
GeneIDi26505
KEGGihsa:26505
UCSCiuc002swy.4 human [Q8NE01-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26505
DisGeNETi26505

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CNNM3
HGNCiHGNC:104 CNNM3
HPAiENSG00000168763 Low tissue specificity
MIMi607804 gene
neXtProtiNX_Q8NE01
OpenTargetsiENSG00000168763
PharmGKBiPA26670

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2118 Eukaryota
COG1253 LUCA
GeneTreeiENSGT00940000161102
HOGENOMiCLU_011310_1_1_1
InParanoidiQ8NE01
KOiK16302
OMAiDPYNEFV
OrthoDBi1446644at2759
PhylomeDBiQ8NE01
TreeFamiTF101012

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CNNM3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26505
PharosiQ8NE01 Tbio

Protein Ontology

More...
PROi
PR:Q8NE01
RNActiQ8NE01 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168763 Expressed in muscle of leg and 196 other tissues
GenevisibleiQ8NE01 HS

Family and domain databases

InterProiView protein in InterPro
IPR000644 CBS_dom
IPR002550 CNNM
PfamiView protein in Pfam
PF00571 CBS, 1 hit
PROSITEiView protein in PROSITE
PS51371 CBS, 2 hits
PS51846 CNNM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNNM3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NE01
Secondary accession number(s): B3KX67
, Q8TBV4, Q96IW4, Q9NRK4, Q9NXW6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2002
Last modified: April 22, 2020
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again