Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (12 Aug 2020)
Sequence version 3 (05 Jul 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable aminopeptidase NPEPL1

Gene

NPEPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+, Mn2+

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi260Zinc 2By similarity1
Metal bindingi265Zinc 1By similarity1
Metal bindingi265Zinc 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei272Sequence analysis1
Metal bindingi283Zinc 2By similarity1
Metal bindingi342Zinc 1By similarity1
Metal bindingi344Zinc 1By similarity1
Metal bindingi344Zinc 2By similarity1
Active sitei346Sequence analysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAminopeptidase, Hydrolase, Protease
LigandManganese, Metal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NDH3

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M17.006

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable aminopeptidase NPEPL1 (EC:3.4.11.-)
Alternative name(s):
Aminopeptidase-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NPEPL1
Synonyms:KIAA1974
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000215440.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16244, NPEPL1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NDH3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79716

Open Targets

More...
OpenTargetsi
ENSG00000215440

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31702

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NDH3, Tdark

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3831223

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NPEPL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
68847034

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001658281 – 523Probable aminopeptidase NPEPL1Add BLAST523

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NDH3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NDH3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NDH3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NDH3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NDH3

PeptideAtlas

More...
PeptideAtlasi
Q8NDH3

PRoteomics IDEntifications database

More...
PRIDEi
Q8NDH3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
22305
34124
73027 [Q8NDH3-1]
73028 [Q8NDH3-2]
73029 [Q8NDH3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NDH3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NDH3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000215440, Expressed in left lobe of thyroid gland and 112 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NDH3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NDH3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000215440, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122832, 23 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NDH3, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000348395

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NDH3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NDH3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M17 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2597, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063255

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_013734_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NDH3

KEGG Orthology (KO)

More...
KOi
K09611

Identification of Orthologs from Complete Genome Data

More...
OMAi
MVCEQSD

Database of Orthologous Groups

More...
OrthoDBi
562530at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NDH3

TreeFam database of animal gene trees

More...
TreeFami
TF314954

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00433, Peptidase_M17, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011356, Leucine_aapep/pepB
IPR041417, NPEPL1_N
IPR000819, Peptidase_M17_C

The PANTHER Classification System

More...
PANTHERi
PTHR11963, PTHR11963, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18295, Pdase_M17_N2, 1 hit
PF00883, Peptidase_M17, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00481, LAMNOPPTDASE

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00631, CYTOSOL_AP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NDH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANVGLQFQA SAGDSDPQSR PLLLLGQLHH LHRVPWSHVR GKLQPRVTEE
60 70 80 90 100
LWQAALSTLN PNPTDSCPLY LNYATVAALP CRVSRHNSPS AAHFITRLVR
110 120 130 140 150
TCLPPGAHRC IVMVCEQPEV FASACALARA FPLFTHRSGA SRRLEKKTVT
160 170 180 190 200
VEFFLVGQDN GPVEVSTLQC LANATDGVRL AARIVDTPCN EMNTDTFLEE
210 220 230 240 250
INKVGKELGI IPTIIRDEEL KTRGFGGIYG VGKAALHPPA LAVLSHTPDG
260 270 280 290 300
ATQTIAWVGK GIVYDTGGLS IKGKTTMPGM KRDCGGAAAV LGAFRAAIKQ
310 320 330 340 350
GFKDNLHAVF CLAENSVGPN ATRPDDIHLL YSGKTVEINN TDAEGRLVLA
360 370 380 390 400
DGVSYACKDL GADIILDMAT LTGAQGIATG KYHAAVLTNS AEWEAACVKA
410 420 430 440 450
GRKCGDLVHP LVYCPELHFS EFTSAVADMK NSVADRDNSP SSCAGLFIAS
460 470 480 490 500
HIGFDWPGVW VHLDIAAPVH AGERATGFGV ALLLALFGRA SEDPLLNLVS
510 520
PLGCEVDVEE GDLGRDSKRR RLV
Length:523
Mass (Da):55,861
Last modified:July 5, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1B00C3422D169C0C
GO
Isoform 2 (identifier: Q8NDH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-412: GIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLV → VSAPWIHPLAVVPGNPTPLLTSRWGRQRVGAAVRKFS
     413-523: Missing.

Show »
Length:412
Mass (Da):44,126
Checksum:i1A5C4C0CD3B96CD0
GO
Isoform 3 (identifier: Q8NDH3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-393: TVEINNTDAE...AAVLTNSAEW → YVWPSHSFLP...GSFGSRRTSR
     394-523: Missing.

Show »
Length:393
Mass (Da):42,135
Checksum:i728A4DE79C551DAB
GO
Isoform 4 (identifier: Q8NDH3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEE → MELHGGNRGGYQPKALEQSGCW

Show »
Length:495
Mass (Da):52,671
Checksum:iC33D390C2734FB8C
GO
Isoform 5 (identifier: Q8NDH3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTE → M

Show »
Length:475
Mass (Da):50,531
Checksum:iDEF6B2175609DF8B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YEP3H0YEP3_HUMAN
Probable aminopeptidase NPEPL1
NPEPL1
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AK307771 differs from that shown. Reason: Frameshift.Curated
The sequence BAB13861 differs from that shown. Reason: Frameshift.Curated
The sequence CAD38816 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti87N → S in BAD96814 (Ref. 2) Curated1
Sequence conflicti151V → L in AK307771 (PubMed:14702039).Curated1
Sequence conflicti204V → A in BAB13861 (PubMed:14702039).Curated1
Sequence conflicti323R → G in BAB13861 (PubMed:14702039).Curated1
Sequence conflicti502L → P in BAG60029 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059756303K → R. Corresponds to variant dbSNP:rs8116292Ensembl.1
Natural variantiVAR_059757513L → V3 PublicationsCorresponds to variant dbSNP:rs6026468Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0445261 – 50MANVG…RVTEE → MELHGGNRGGYQPKALEQSG CW in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0445271 – 49MANVG…PRVTE → M in isoform 5. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_007251335 – 393TVEIN…NSAEW → YVWPSHSFLPTVGTRDPSRP AMPAHSRHIGRALSVGVPWA AGSLLPGGLGSFGSRRTSR in isoform 3. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_007253376 – 412GIATG…VHPLV → VSAPWIHPLAVVPGNPTPLL TSRWGRQRVGAAVRKFS in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_007252394 – 523Missing in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_007254413 – 523Missing in isoform 2. 1 PublicationAdd BLAST111

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK021645 mRNA Translation: BAB13861.1 Frameshift.
AK297667 mRNA Translation: BAG60029.1
AK307771 mRNA No translation available.
AK223094 mRNA Translation: BAD96814.1
AL139349 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75479.1
BC020507 mRNA Translation: AAH20507.2
AB075854 mRNA Translation: BAB85560.1
AL833971 mRNA Translation: CAD38816.2 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46621.1 [Q8NDH3-1]
CCDS56200.1 [Q8NDH3-4]
CCDS56201.1 [Q8NDH3-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001191801.1, NM_001204872.1 [Q8NDH3-4]
NP_001191802.1, NM_001204873.1 [Q8NDH3-5]
NP_078939.3, NM_024663.3 [Q8NDH3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356091; ENSP00000348395; ENSG00000215440 [Q8NDH3-1]
ENST00000525817; ENSP00000437112; ENSG00000215440 [Q8NDH3-5]
ENST00000525967; ENSP00000434810; ENSG00000215440 [Q8NDH3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79716

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79716

UCSC genome browser

More...
UCSCi
uc010gjo.3, human [Q8NDH3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021645 mRNA Translation: BAB13861.1 Frameshift.
AK297667 mRNA Translation: BAG60029.1
AK307771 mRNA No translation available.
AK223094 mRNA Translation: BAD96814.1
AL139349 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75479.1
BC020507 mRNA Translation: AAH20507.2
AB075854 mRNA Translation: BAB85560.1
AL833971 mRNA Translation: CAD38816.2 Frameshift.
CCDSiCCDS46621.1 [Q8NDH3-1]
CCDS56200.1 [Q8NDH3-4]
CCDS56201.1 [Q8NDH3-5]
RefSeqiNP_001191801.1, NM_001204872.1 [Q8NDH3-4]
NP_001191802.1, NM_001204873.1 [Q8NDH3-5]
NP_078939.3, NM_024663.3 [Q8NDH3-1]

3D structure databases

SMRiQ8NDH3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122832, 23 interactors
IntActiQ8NDH3, 3 interactors
STRINGi9606.ENSP00000348395

Chemistry databases

ChEMBLiCHEMBL3831223

Protein family/group databases

MEROPSiM17.006

PTM databases

iPTMnetiQ8NDH3
PhosphoSitePlusiQ8NDH3

Polymorphism and mutation databases

BioMutaiNPEPL1
DMDMi68847034

Proteomic databases

EPDiQ8NDH3
jPOSTiQ8NDH3
MassIVEiQ8NDH3
MaxQBiQ8NDH3
PaxDbiQ8NDH3
PeptideAtlasiQ8NDH3
PRIDEiQ8NDH3
ProteomicsDBi22305
34124
73027 [Q8NDH3-1]
73028 [Q8NDH3-2]
73029 [Q8NDH3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29150, 77 antibodies

The DNASU plasmid repository

More...
DNASUi
79716

Genome annotation databases

EnsembliENST00000356091; ENSP00000348395; ENSG00000215440 [Q8NDH3-1]
ENST00000525817; ENSP00000437112; ENSG00000215440 [Q8NDH3-5]
ENST00000525967; ENSP00000434810; ENSG00000215440 [Q8NDH3-4]
GeneIDi79716
KEGGihsa:79716
UCSCiuc010gjo.3, human [Q8NDH3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79716
DisGeNETi79716
EuPathDBiHostDB:ENSG00000215440.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NPEPL1
HGNCiHGNC:16244, NPEPL1
HPAiENSG00000215440, Low tissue specificity
neXtProtiNX_Q8NDH3
OpenTargetsiENSG00000215440
PharmGKBiPA31702

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2597, Eukaryota
GeneTreeiENSGT00530000063255
HOGENOMiCLU_013734_3_1_1
InParanoidiQ8NDH3
KOiK09611
OMAiMVCEQSD
OrthoDBi562530at2759
PhylomeDBiQ8NDH3
TreeFamiTF314954

Enzyme and pathway databases

PathwayCommonsiQ8NDH3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79716, 7 hits in 871 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79716
PharosiQ8NDH3, Tdark

Protein Ontology

More...
PROi
PR:Q8NDH3
RNActiQ8NDH3, protein

Gene expression databases

BgeeiENSG00000215440, Expressed in left lobe of thyroid gland and 112 other tissues
ExpressionAtlasiQ8NDH3, baseline and differential
GenevisibleiQ8NDH3, HS

Family and domain databases

CDDicd00433, Peptidase_M17, 1 hit
InterProiView protein in InterPro
IPR011356, Leucine_aapep/pepB
IPR041417, NPEPL1_N
IPR000819, Peptidase_M17_C
PANTHERiPTHR11963, PTHR11963, 1 hit
PfamiView protein in Pfam
PF18295, Pdase_M17_N2, 1 hit
PF00883, Peptidase_M17, 1 hit
PRINTSiPR00481, LAMNOPPTDASE
PROSITEiView protein in PROSITE
PS00631, CYTOSOL_AP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPEPL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NDH3
Secondary accession number(s): A6NGZ0
, B4DMW7, B7ZBN0, E9PN47, G5EA34, Q53G37, Q5W083, Q8TF28, Q8WUI2, Q9H1T6, Q9HAI5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: July 5, 2005
Last modified: August 12, 2020
This is version 154 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families
  5. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again