Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NCW0 (KREM2_HUMAN)

Entry version 157 (07 Apr 2021)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Kremen protein 2

Gene

KREMEN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Plays a role in limb development; attenuates Wnt signaling in the developing limb to allow normal limb patterning and can also negatively regulate bone formation.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processWnt signaling pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8NCW0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-201681, TCF dependent signaling in response to WNT
R-HSA-3772470, Negative regulation of TCF-dependent signaling by WNT ligand antagonists
R-HSA-5339717, Signaling by LRP5 mutants

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8NCW0

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8NCW0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kremen protein 2
Alternative name(s):
Dickkopf receptor 2
Kringle domain-containing transmembrane protein 2
Kringle-containing protein marking the eye and the nose
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KREMEN2
Synonyms:KRM2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18797, KREMEN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609899, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NCW0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000131650.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 364ExtracellularSequence analysisAdd BLAST339
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei365 – 387HelicalSequence analysisAdd BLAST23
Topological domaini388 – 462CytoplasmicSequence analysisAdd BLAST75

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		79412

Open Targets

More...OpenTargetsi		ENSG00000131650

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38683

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NCW0, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KREMEN2

Domain mapping of disease mutations (DMDM)

More...DMDMi		30173086

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002156826 – 462Kremen protein 2Add BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi36 ↔ 119By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi49N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi60 ↔ 100By similarity
Disulfide bondi89 ↔ 114By similarity
Disulfide bondi219 ↔ 245By similarity
Glycosylationi222N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi244N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi351N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8NCW0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NCW0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NCW0

PeptideAtlas

More...PeptideAtlasi		Q8NCW0

PRoteomics IDEntifications database

More...PRIDEi		Q8NCW0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		47024
5431
72953 [Q8NCW0-1]
72954 [Q8NCW0-2]
72955 [Q8NCW0-3]
72956 [Q8NCW0-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8NCW0, 5 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NCW0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NCW0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000131650, Expressed in ectocervix and 86 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NCW0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000131650, Tissue enhanced (lymphoid tissue, skin)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ERLEC1.

Forms a ternary complex with DKK1 and LRP6.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		122662, 4 interactors

Protein interaction database and analysis system

More...IntActi		Q8NCW0, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000304422

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NCW0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NCW0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 119KringlePROSITE-ProRule annotationAdd BLAST85
Domaini121 – 215WSCPROSITE-ProRule annotationCuratedAdd BLAST95
Domaini219 – 326CUBPROSITE-ProRule annotationCuratedAdd BLAST108

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binding to ERLEC1 is mediated by the oligosaccharides linked to the kringle domain.By similarity

Keywords - Domaini

Kringle, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4157, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162126

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_047976_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NCW0

Identification of Orthologs from Complete Genome Data

More...OMAi		GRSWAVW

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NCW0

TreeFam database of animal gene trees

More...TreeFami		TF331319

Family and domain databases

Conserved Domains Database

More...CDDi		cd00041, CUB, 1 hit
cd00108, KR, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.40.20.10, 1 hit
2.60.120.290, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000859, CUB_dom
IPR017076, Kremen
IPR000001, Kringle
IPR013806, Kringle-like
IPR018056, Kringle_CS
IPR038178, Kringle_sf
IPR035914, Sperma_CUB_dom_sf
IPR002889, WSC_carb-bd

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00431, CUB, 1 hit
PF00051, Kringle, 1 hit
PF01822, WSC, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF036961, Kremen, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00042, CUB, 1 hit
SM00130, KR, 1 hit
SM00321, WSC, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49854, SSF49854, 1 hit
SSF57440, SSF57440, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01180, CUB, 1 hit
PS00021, KRINGLE_1, 1 hit
PS50070, KRINGLE_2, 1 hit
PS51212, WSC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1Curated (identifier: Q8NCW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTQALQGFL FLLFLPLLQP RGASAGSLHS PGLSECFQVN GADYRGHQNR 
        60         70         80         90        100
TGPRGAGRPC LFWDQTQQHS YSSASDPHGR WGLGAHNFCR NPDGDVQPWC 
       110        120        130        140        150
YVAETEEGIY WRYCDIPSCH MPGYLGCFVD SGAPPALSGP SGTSTKLTVQ 
       160        170        180        190        200
VCLRFCRMKG YQLAGVEAGY ACFCGSESDL ARGRLAPATD CDQICFGHPG 
       210        220        230        240        250
QLCGGDGRLG VYEVSVGSCQ GNWTAPQGVI YSPDFPDEYG PDRNCSWALG 
       260        270        280        290        300
PPGAALELTF RLFELADPRD RLELRDAASG SLLRAFDGAR PPPSGPLRLG 
       310        320        330        340        350
TAALLLTFRS DARGHAQGFA LTYRGLQDAA EDPEAPEGSA QTPAAPLDGA 
       360        370        380        390        400
NVSCSPRPGA PPAAIGARVF STVTAVSVLL LLLLGLLRPL RRRSCLLAPG 
       410        420        430        440        450
KGPPALGASR GPRRSWAVWY QQPRGVALPC SPGDPQAEGS AAGYRPLSAS 
       460 
SQSSLRSLIS AL
Length:462
Mass (Da):48,849
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCE33015917A9AA68
GO
Isoform 2Curated (identifier: Q8NCW0-2) [UniParc]FASTAAdd to basket
Also known as: Kremen2a

The sequence of this isoform differs from the canonical sequence as follows:
     394-424: SCLLAPGKGPPALGASRGPRRSWAVWYQQPR → CGALGQGLRADRWWGAGAPEGNRARKELLGS
     425-462: Missing.

Show »
Length:424
Mass (Da):45,055
Checksum:i376B000839A519C4
GO
Isoform 3Curated (identifier: Q8NCW0-3) [UniParc]FASTAAdd to basket
Also known as: Kremen2b

The sequence of this isoform differs from the canonical sequence as follows:
     367-420: ARVFSTVTAV...GPRRSWAVWY → GAVCWLREKG...LRVLPRATGL
     421-462: Missing.

Show »
Length:420
Mass (Da):44,403
Checksum:i75C4479C67BA0D6E
GO
Isoform 4Curated (identifier: Q8NCW0-4) [UniParc]FASTAAdd to basket
Also known as: Kremen2c

The sequence of this isoform differs from the canonical sequence as follows:
     367-399: ARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAP → GEAGARDGSESGSRPLAPILTAAVCPQPGSSRR
     400-462: Missing.

Show »
Length:399
Mass (Da):42,037
Checksum:i5F677BDEBA72E0D3
GO
Isoform 5 (identifier: Q8NCW0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-200: Missing.

Show »
Length:423
Mass (Da):44,880
Checksum:i47DB607DAAB94F9C
GO
Isoform 6 (identifier: Q8NCW0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-200: Missing.
     367-462: ARVFSTVTAV...SSLRSLISAL → GAVCWLREKG...LRVLPRATGL

Show »
Length:381
Mass (Da):40,433
Checksum:i454966A1E691F3D0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164 – 202Missing in BAC11365 (PubMed:14702039).CuratedAdd BLAST39
Sequence conflicti285A → D in BAC11365 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059691408A → P. Corresponds to variant dbSNP:rs11866302Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046399162 – 200Missing in isoform 5 and isoform 6. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_047386367 – 462ARVFS…LISAL → GAVCWLREKGPRRWGLPGAP GEAGLCGTNSPEGWPCPAPP GTPRLRVLPRATGL in isoform 6. CuratedAdd BLAST96
Alternative sequenceiVSP_050511367 – 420ARVFS…WAVWY → GAVCWLREKGPRRWGLPGAP GEAGLCGTNSPEGWPCPAPP GTPRLRVLPRATGL in isoform 3. 2 PublicationsAdd BLAST54
Alternative sequenceiVSP_050513367 – 399ARVFS…CLLAP → GEAGARDGSESGSRPLAPIL TAAVCPQPGSSRR in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_050509394 – 424SCLLA…YQQPR → CGALGQGLRADRWWGAGAPE GNRARKELLGS in isoform 2. CuratedAdd BLAST31
Alternative sequenceiVSP_050514400 – 462Missing in isoform 4. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_050512421 – 462Missing in isoform 3. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_050510425 – 462Missing in isoform 2. CuratedAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB086405 mRNA Translation: BAC00872.1
AB086355 mRNA Translation: BAC00823.1
AB086356 mRNA Translation: BAC00824.1
AB086357 mRNA Translation: BAC00825.1
AK027669 mRNA Translation: BAB55281.1
AK075033 mRNA Translation: BAC11365.1
AK301953 mRNA Translation: BAG63368.1
AC004235 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85449.1
BC003533 mRNA Translation: AAH03533.1
BC009383 mRNA Translation: AAH09383.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10483.1 [Q8NCW0-1]
CCDS10484.1 [Q8NCW0-3]
CCDS58412.1 [Q8NCW0-5]
CCDS58413.1 [Q8NCW0-6]

NCBI Reference Sequences

More...RefSeqi		NP_001240654.1, NM_001253725.1 [Q8NCW0-6]
NP_001240655.1, NM_001253726.1 [Q8NCW0-5]
NP_078783.1, NM_024507.3 [Q8NCW0-3]
NP_757384.1, NM_172229.2 [Q8NCW0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000303746; ENSP00000304422; ENSG00000131650 [Q8NCW0-1]
ENST00000319500; ENSP00000322079; ENSG00000131650 [Q8NCW0-3]
ENST00000571007; ENSP00000461860; ENSG00000131650 [Q8NCW0-5]
ENST00000572045; ENSP00000460578; ENSG00000131650 [Q8NCW0-4]
ENST00000575769; ENSP00000460917; ENSG00000131650 [Q8NCW0-2]
ENST00000575885; ENSP00000459878; ENSG00000131650 [Q8NCW0-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		79412

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:79412

UCSC genome browser

More...UCSCi		uc002csg.4, human [Q8NCW0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB086405 mRNA Translation: BAC00872.1
AB086355 mRNA Translation: BAC00823.1
AB086356 mRNA Translation: BAC00824.1
AB086357 mRNA Translation: BAC00825.1
AK027669 mRNA Translation: BAB55281.1
AK075033 mRNA Translation: BAC11365.1
AK301953 mRNA Translation: BAG63368.1
AC004235 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85449.1
BC003533 mRNA Translation: AAH03533.1
BC009383 mRNA Translation: AAH09383.1
CCDSiCCDS10483.1 [Q8NCW0-1]
CCDS10484.1 [Q8NCW0-3]
CCDS58412.1 [Q8NCW0-5]
CCDS58413.1 [Q8NCW0-6]
RefSeqiNP_001240654.1, NM_001253725.1 [Q8NCW0-6]
NP_001240655.1, NM_001253726.1 [Q8NCW0-5]
NP_078783.1, NM_024507.3 [Q8NCW0-3]
NP_757384.1, NM_172229.2 [Q8NCW0-1]

3D structure databases

SMRiQ8NCW0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122662, 4 interactors
IntActiQ8NCW0, 1 interactor
STRINGi9606.ENSP00000304422

PTM databases

GlyGeniQ8NCW0, 5 sites
iPTMnetiQ8NCW0
PhosphoSitePlusiQ8NCW0

Genetic variation databases

BioMutaiKREMEN2
DMDMi30173086

Proteomic databases

EPDiQ8NCW0
MassIVEiQ8NCW0
PaxDbiQ8NCW0
PeptideAtlasiQ8NCW0
PRIDEiQ8NCW0
ProteomicsDBi47024
5431
72953 [Q8NCW0-1]
72954 [Q8NCW0-2]
72955 [Q8NCW0-3]
72956 [Q8NCW0-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1159, 119 antibodies

The DNASU plasmid repository

More...DNASUi		79412

Genome annotation databases

EnsembliENST00000303746; ENSP00000304422; ENSG00000131650 [Q8NCW0-1]
ENST00000319500; ENSP00000322079; ENSG00000131650 [Q8NCW0-3]
ENST00000571007; ENSP00000461860; ENSG00000131650 [Q8NCW0-5]
ENST00000572045; ENSP00000460578; ENSG00000131650 [Q8NCW0-4]
ENST00000575769; ENSP00000460917; ENSG00000131650 [Q8NCW0-2]
ENST00000575885; ENSP00000459878; ENSG00000131650 [Q8NCW0-6]
GeneIDi79412
KEGGihsa:79412
UCSCiuc002csg.4, human [Q8NCW0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		79412
DisGeNETi79412

GeneCards: human genes, protein and diseases

More...GeneCardsi		KREMEN2
HGNCiHGNC:18797, KREMEN2
HPAiENSG00000131650, Tissue enhanced (lymphoid tissue, skin)
MIMi609899, gene
neXtProtiNX_Q8NCW0
OpenTargetsiENSG00000131650
PharmGKBiPA38683
VEuPathDBiHostDB:ENSG00000131650.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4157, Eukaryota
GeneTreeiENSGT00940000162126
HOGENOMiCLU_047976_0_0_1
InParanoidiQ8NCW0
OMAiGRSWAVW
PhylomeDBiQ8NCW0
TreeFamiTF331319

Enzyme and pathway databases

PathwayCommonsiQ8NCW0
ReactomeiR-HSA-201681, TCF dependent signaling in response to WNT
R-HSA-3772470, Negative regulation of TCF-dependent signaling by WNT ligand antagonists
R-HSA-5339717, Signaling by LRP5 mutants
SignaLinkiQ8NCW0
SIGNORiQ8NCW0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		79412, 12 hits in 993 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		79412
PharosiQ8NCW0, Tbio

Protein Ontology

More...PROi		PR:Q8NCW0
RNActiQ8NCW0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000131650, Expressed in ectocervix and 86 other tissues
GenevisibleiQ8NCW0, HS

Family and domain databases

CDDicd00041, CUB, 1 hit
cd00108, KR, 1 hit
Gene3Di2.40.20.10, 1 hit
2.60.120.290, 1 hit
InterProiView protein in InterPro
IPR000859, CUB_dom
IPR017076, Kremen
IPR000001, Kringle
IPR013806, Kringle-like
IPR018056, Kringle_CS
IPR038178, Kringle_sf
IPR035914, Sperma_CUB_dom_sf
IPR002889, WSC_carb-bd
PfamiView protein in Pfam
PF00431, CUB, 1 hit
PF00051, Kringle, 1 hit
PF01822, WSC, 1 hit
PIRSFiPIRSF036961, Kremen, 1 hit
SMARTiView protein in SMART
SM00042, CUB, 1 hit
SM00130, KR, 1 hit
SM00321, WSC, 1 hit
SUPFAMiSSF49854, SSF49854, 1 hit
SSF57440, SSF57440, 1 hit
PROSITEiView protein in PROSITE
PS01180, CUB, 1 hit
PS00021, KRINGLE_1, 1 hit
PS50070, KRINGLE_2, 1 hit
PS51212, WSC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKREM2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NCW0
Secondary accession number(s): B4DXF6
, I3L2S2, Q8N2J4, Q8NCW1, Q96GL8, Q9BTP9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: October 1, 2002
Last modified: April 7, 2021
This is version 157 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again