Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (29 Sep 2021)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Adenosine deaminase domain-containing protein 2

Gene

ADAD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NCV1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adenosine deaminase domain-containing protein 2
Alternative name(s):
Testis nuclear RNA-binding protein-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAD2
Synonyms:TENRL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30714, ADAD2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NCV1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000140955

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
161931

Open Targets

More...
OpenTargetsi
ENSG00000140955

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162375591

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NCV1, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADAD2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730183

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003095241 – 583Adenosine deaminase domain-containing protein 2Add BLAST583

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NCV1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NCV1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NCV1

PeptideAtlas

More...
PeptideAtlasi
Q8NCV1

PRoteomics IDEntifications database

More...
PRIDEi
Q8NCV1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72951 [Q8NCV1-1]
72952 [Q8NCV1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NCV1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NCV1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140955, Expressed in right testis and 171 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NCV1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NCV1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000140955, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127807, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000268624

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NCV1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini115 – 181DRBMPROSITE-ProRule annotationAdd BLAST67
Domaini261 – 582A to I editasePROSITE-ProRule annotationAdd BLAST322

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 48DisorderedSequence analysisAdd BLAST48

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ADAD family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2777, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161900

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005382_4_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NCV1

Identification of Orthologs from Complete Genome Data

More...
OMAi
SCAGWLE

Database of Orthologous Groups

More...
OrthoDBi
947117at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NCV1

TreeFam database of animal gene trees

More...
TreeFami
TF315806

Family and domain databases

Conserved Domains Database

More...
CDDi
cd19906, DSRM_ADAD2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002466, A_deamin
IPR044454, ADAD2_DSRM
IPR014720, dsRBD_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02137, A_deamin, 1 hit
PF00035, dsrm, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00552, ADEAMc, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50141, A_DEAMIN_EDITASE, 1 hit
PS50137, DS_RBD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NCV1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASASQGADD DGSRRKPRLA ASLQISPQPR PWRPLPAQAQ SAWGPAPAPA
60 70 80 90 100
TYRAEGGWPQ VSVLRDSGPG AGAGVGELGA ARAWENLGEQ MGKAPRVPVP
110 120 130 140 150
PAGLSLPLKD PPASQAVSLL TEYAASLGIF LLFREDQPPG PCFPFSVSAE
160 170 180 190 200
LDGVVCPAGT ANSKTEAKQQ AALSALCYIR SQLENPESPQ TSSRPPLAPL
210 220 230 240 250
SVENILTHEQ RCAALVSAGF DLLLDERSPY WACKGTVAGV ILEREIPRAR
260 270 280 290 300
GHVKEIYKLV ALGTGSSCCA GWLEFSGQQL HDCHGLVIAR RALLRFLFRQ
310 320 330 340 350
LLLATQGGPK GKEQSVLAPQ PGPGPPFTLK PRVFLHLYIS NTPKGAARDI
360 370 380 390 400
YLPPTSEGGL PHSPPMRLQA HVLGQLKPVC YVAPSLCDTH VGCLSASDKL
410 420 430 440 450
ARWAVLGLGG ALLAHLVSPL YSTSLILADS CHDPPTLSRA IHTRPCLDSV
460 470 480 490 500
LGPCLPPPYV RTALHLFAGP PVAPSEPTPD TCRGLSLNWS LGDPGIEVVD
510 520 530 540 550
VATGRVKANA ALGPPSRLCK ASFLRAFHQA ARAVGKPYLL ALKTYEAAKA
560 570 580
GPYQEARRQL SLLLDQQGLG AWPSKPLVGK FRN
Length:583
Mass (Da):61,755
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8F1566C88111FAD7
GO
Isoform 2 (identifier: Q8NCV1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL
     244-244: R → RGWAVSAPSCT

Show »
Length:665
Mass (Da):70,989
Checksum:iC0E570BBE5F08016
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BNP6H3BNP6_HUMAN
Adenosine deaminase domain-containi...
ADAD2
267Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03697644G → E2 PublicationsCorresponds to variant dbSNP:rs8044695Ensembl.1
Natural variantiVAR_055650235G → R. Corresponds to variant dbSNP:rs11149631Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029230139P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2. 1 Publication1
Alternative sequenceiVSP_029231244R → RGWAVSAPSCT in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF447586 mRNA Translation: AAM22869.1
AK093046 mRNA Translation: BAC04032.1
AK315171 mRNA Translation: BAG37613.1
CH471114 Genomic DNA Translation: EAW95491.1
CH471114 Genomic DNA Translation: EAW95492.1
BC033491 mRNA Translation: AAH33491.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10944.1 [Q8NCV1-2]
CCDS45536.1 [Q8NCV1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001138872.1, NM_001145400.1 [Q8NCV1-1]
NP_631913.3, NM_139174.3 [Q8NCV1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268624; ENSP00000268624; ENSG00000140955 [Q8NCV1-2]
ENST00000315906; ENSP00000325153; ENSG00000140955 [Q8NCV1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
161931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:161931

UCSC genome browser

More...
UCSCi
uc002fhq.3, human [Q8NCV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF447586 mRNA Translation: AAM22869.1
AK093046 mRNA Translation: BAC04032.1
AK315171 mRNA Translation: BAG37613.1
CH471114 Genomic DNA Translation: EAW95491.1
CH471114 Genomic DNA Translation: EAW95492.1
BC033491 mRNA Translation: AAH33491.1
CCDSiCCDS10944.1 [Q8NCV1-2]
CCDS45536.1 [Q8NCV1-1]
RefSeqiNP_001138872.1, NM_001145400.1 [Q8NCV1-1]
NP_631913.3, NM_139174.3 [Q8NCV1-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi127807, 6 interactors
STRINGi9606.ENSP00000268624

PTM databases

iPTMnetiQ8NCV1
PhosphoSitePlusiQ8NCV1

Genetic variation databases

BioMutaiADAD2
DMDMi74730183

Proteomic databases

jPOSTiQ8NCV1
MassIVEiQ8NCV1
PaxDbiQ8NCV1
PeptideAtlasiQ8NCV1
PRIDEiQ8NCV1
ProteomicsDBi72951 [Q8NCV1-1]
72952 [Q8NCV1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30571, 68 antibodies

The DNASU plasmid repository

More...
DNASUi
161931

Genome annotation databases

EnsembliENST00000268624; ENSP00000268624; ENSG00000140955 [Q8NCV1-2]
ENST00000315906; ENSP00000325153; ENSG00000140955 [Q8NCV1-1]
GeneIDi161931
KEGGihsa:161931
UCSCiuc002fhq.3, human [Q8NCV1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
161931
DisGeNETi161931

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADAD2
HGNCiHGNC:30714, ADAD2
HPAiENSG00000140955, Tissue enriched (testis)
neXtProtiNX_Q8NCV1
OpenTargetsiENSG00000140955
PharmGKBiPA162375591
VEuPathDBiHostDB:ENSG00000140955

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2777, Eukaryota
GeneTreeiENSGT00940000161900
HOGENOMiCLU_005382_4_2_1
InParanoidiQ8NCV1
OMAiSCAGWLE
OrthoDBi947117at2759
PhylomeDBiQ8NCV1
TreeFamiTF315806

Enzyme and pathway databases

PathwayCommonsiQ8NCV1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
161931, 7 hits in 1007 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
161931
PharosiQ8NCV1, Tdark

Protein Ontology

More...
PROi
PR:Q8NCV1
RNActiQ8NCV1, protein

Gene expression databases

BgeeiENSG00000140955, Expressed in right testis and 171 other tissues
ExpressionAtlasiQ8NCV1, baseline and differential
GenevisibleiQ8NCV1, HS

Family and domain databases

CDDicd19906, DSRM_ADAD2, 1 hit
InterProiView protein in InterPro
IPR002466, A_deamin
IPR044454, ADAD2_DSRM
IPR014720, dsRBD_dom
PfamiView protein in Pfam
PF02137, A_deamin, 1 hit
PF00035, dsrm, 1 hit
SMARTiView protein in SMART
SM00552, ADEAMc, 1 hit
PROSITEiView protein in PROSITE
PS50141, A_DEAMIN_EDITASE, 1 hit
PS50137, DS_RBD, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADAD2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NCV1
Secondary accession number(s): B2RCL6, Q8NA94
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: October 1, 2002
Last modified: September 29, 2021
This is version 129 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again