Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein KIAA0895

Gene

KIAA0895

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA0895
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164542.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:22206 KIAA0895

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NCT3

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000164542

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164721801

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIAA0895

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172045806

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003206171 – 520Uncharacterized protein KIAA0895Add BLAST520

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NCT3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NCT3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NCT3

PeptideAtlas

More...
PeptideAtlasi
Q8NCT3

PRoteomics IDEntifications database

More...
PRIDEi
Q8NCT3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
72940
72941 [Q8NCT3-2]
72942 [Q8NCT3-3]
72943 [Q8NCT3-4]
72944 [Q8NCT3-5]
72945 [Q8NCT3-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NCT3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NCT3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164542 Expressed in 194 organ(s), highest expression level in neocortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NCT3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NCT3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021036
HPA061066

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116946, 1 interactor

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8NCT3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi12 – 51Arg-richAdd BLAST40

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGSS Eukaryota
ENOG410YKC2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004417

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000069902

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG067127

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NCT3

Identification of Orthologs from Complete Genome Data

More...
OMAi
QPGCFNK

Database of Orthologous Groups

More...
OrthoDBi
749754at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NCT3

TreeFam database of animal gene trees

More...
TreeFami
TF329621

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012548 DUF1704

The PANTHER Classification System

More...
PANTHERi
PTHR31817 PTHR31817, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08014 DUF1704, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01154 DUF1704, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NCT3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGCTRKLTH LRKRIHRPRR RTTRRWKRWF KFRKRKGEKR PRPNHKAVAR
60 70 80 90 100
RAKLKFSTSE KLHWPEQELA KKSILNAEDS LIIDNKRSIS HLSSGVLKDI
110 120 130 140 150
FTTGTSSYNV LLQSKEEKKY HSQKQSSSTY SKRCRKPSKS PNTSRSKDPR
160 170 180 190 200
RMKALVPVTS SGTWYCLERR PAVFVTSSVS SPVKFTHDIS VTGNGIVLPP
210 220 230 240 250
KPKSKVKWCH FSTLPKPKPQ LSRSFEKGDD FSGKKFCILT AIKPTNLEKE
260 270 280 290 300
KLRFFKSDYT YNPQFEYANP ALPSVLAKHS HASDRFLKQI VVHLTEDLLS
310 320 330 340 350
RASMTVVNGC PTLTINVSTA REHWLEGMLR HEIGTHYFRG INNLQQPWNS
360 370 380 390 400
WTGRKKHELK PNNPTEEGLA SIHSVLFRKD PFLWRAALLY YTVYQASQMS
410 420 430 440 450
FCELFKDIGR FVKDPNTRWD YCVRAKRGWT DTSQPGCFSK DQVYLDGILQ
460 470 480 490 500
ILRYRDTIDF HLLTALGKVS YEDVDRLKGL AVTENMRVPH FLQDHGRYME
510 520
HLEKIMEVNE LTDRELKDLI
Length:520
Mass (Da):60,525
Last modified:February 26, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1803AA8CB1D8FC44
GO
Isoform 2 (identifier: Q8NCT3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAGCTRKLTH...RAKLKFSTSE → MVATGWARRS...PLILSSLIIK

Note: No experimental confirmation available.
Show »
Length:507
Mass (Da):58,304
Checksum:iDBEA7A2FA1089549
GO
Isoform 3 (identifier: Q8NCT3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTS → MLESIRVT

Show »
Length:469
Mass (Da):54,050
Checksum:i4ACBBE723E89EE1A
GO
Isoform 4 (identifier: Q8NCT3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAGCTRKLTH...RAKLKFSTSE → MVATGWARRS...PLILSSLIIK
     290-520: IVVHLTEDLL...LTDRELKDLI → VKCHFNSGSSFLCTKTIICDLISKNKDI

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):34,377
Checksum:i068946E2C006F2CC
GO
Isoform 5 (identifier: Q8NCT3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     289-289: Q → QSINIMELTLQKYGSYEKFEQATGGSLLSKTRIWSHVRKYMMKEGCLGE

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):48,113
Checksum:iA5BF78777232B5D5
GO
Isoform 6 (identifier: Q8NCT3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTS → MLESIRVT
     289-289: Q → QSINIMELTLQKYGSYEKFEQATGGSLLSKTRIWSHVRKYMMKEGCLGE

Note: No experimental confirmation available.
Show »
Length:517
Mass (Da):59,575
Checksum:iC4292015EC48DB42
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PE22E9PE22_HUMAN
Uncharacterized protein KIAA0895
KIAA0895
275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWZ6C9JWZ6_HUMAN
Uncharacterized protein KIAA0895
KIAA0895
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGM1C9JGM1_HUMAN
Uncharacterized protein KIAA0895
KIAA0895
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA74918 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti117E → K in BAA74918 (PubMed:10048485).Curated1
Sequence conflicti281 – 282HA → P in AAH28678 (PubMed:15489334).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0433221 – 151Missing in isoform 5. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0316851 – 60MAGCT…FSTSE → MVATGWARRSGLHPAPRPLR GAQEALAKNLWREERNRPLI LSSLIIK in isoform 2 and isoform 4. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0316861 – 59MAGCT…KFSTS → MLESIRVT in isoform 3 and isoform 6. 2 PublicationsAdd BLAST59
Alternative sequenceiVSP_043323289Q → QSINIMELTLQKYGSYEKFE QATGGSLLSKTRIWSHVRKY MMKEGCLGE in isoform 5 and isoform 6. 2 Publications1
Alternative sequenceiVSP_031687290 – 520IVVHL…LKDLI → VKCHFNSGSSFLCTKTIICD LISKNKDI in isoform 4. 1 PublicationAdd BLAST231

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB020702 mRNA Translation: BAA74918.1 Different initiation.
AK293912 mRNA Translation: BAG57296.1
AC006960 Genomic DNA No translation available.
BC028678 mRNA Translation: AAH28678.3
BC056191 mRNA Translation: AAH56191.2
BC110422 mRNA Translation: AAI10423.1
BC136362 mRNA Translation: AAI36363.1
BC144032 mRNA Translation: AAI44033.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43570.1 [Q8NCT3-1]
CCDS47573.1 [Q8NCT3-3]
CCDS56482.1 [Q8NCT3-5]
CCDS56483.1 [Q8NCT3-2]
CCDS56484.1 [Q8NCT3-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001093895.1, NM_001100425.1 [Q8NCT3-1]
NP_001186635.1, NM_001199706.1 [Q8NCT3-6]
NP_001186636.1, NM_001199707.1 [Q8NCT3-2]
NP_001186637.1, NM_001199708.1 [Q8NCT3-5]
NP_056129.2, NM_015314.2 [Q8NCT3-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.6224
Hs.735371

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297063; ENSP00000297063; ENSG00000164542 [Q8NCT3-1]
ENST00000317020; ENSP00000319251; ENSG00000164542 [Q8NCT3-3]
ENST00000338533; ENSP00000344805; ENSG00000164542 [Q8NCT3-2]
ENST00000415803; ENSP00000400749; ENSG00000164542 [Q8NCT3-4]
ENST00000436884; ENSP00000389985; ENSG00000164542 [Q8NCT3-5]
ENST00000440378; ENSP00000390837; ENSG00000164542 [Q8NCT3-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23366

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23366

UCSC genome browser

More...
UCSCi
uc003tfb.3 human [Q8NCT3-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB020702 mRNA Translation: BAA74918.1 Different initiation.
AK293912 mRNA Translation: BAG57296.1
AC006960 Genomic DNA No translation available.
BC028678 mRNA Translation: AAH28678.3
BC056191 mRNA Translation: AAH56191.2
BC110422 mRNA Translation: AAI10423.1
BC136362 mRNA Translation: AAI36363.1
BC144032 mRNA Translation: AAI44033.1
CCDSiCCDS43570.1 [Q8NCT3-1]
CCDS47573.1 [Q8NCT3-3]
CCDS56482.1 [Q8NCT3-5]
CCDS56483.1 [Q8NCT3-2]
CCDS56484.1 [Q8NCT3-6]
RefSeqiNP_001093895.1, NM_001100425.1 [Q8NCT3-1]
NP_001186635.1, NM_001199706.1 [Q8NCT3-6]
NP_001186636.1, NM_001199707.1 [Q8NCT3-2]
NP_001186637.1, NM_001199708.1 [Q8NCT3-5]
NP_056129.2, NM_015314.2 [Q8NCT3-3]
UniGeneiHs.6224
Hs.735371

3D structure databases

ProteinModelPortaliQ8NCT3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116946, 1 interactor

PTM databases

iPTMnetiQ8NCT3
PhosphoSitePlusiQ8NCT3

Polymorphism and mutation databases

BioMutaiKIAA0895
DMDMi172045806

Proteomic databases

jPOSTiQ8NCT3
MaxQBiQ8NCT3
PaxDbiQ8NCT3
PeptideAtlasiQ8NCT3
PRIDEiQ8NCT3
ProteomicsDBi72940
72941 [Q8NCT3-2]
72942 [Q8NCT3-3]
72943 [Q8NCT3-4]
72944 [Q8NCT3-5]
72945 [Q8NCT3-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297063; ENSP00000297063; ENSG00000164542 [Q8NCT3-1]
ENST00000317020; ENSP00000319251; ENSG00000164542 [Q8NCT3-3]
ENST00000338533; ENSP00000344805; ENSG00000164542 [Q8NCT3-2]
ENST00000415803; ENSP00000400749; ENSG00000164542 [Q8NCT3-4]
ENST00000436884; ENSP00000389985; ENSG00000164542 [Q8NCT3-5]
ENST00000440378; ENSP00000390837; ENSG00000164542 [Q8NCT3-6]
GeneIDi23366
KEGGihsa:23366
UCSCiuc003tfb.3 human [Q8NCT3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23366
EuPathDBiHostDB:ENSG00000164542.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIAA0895
HGNCiHGNC:22206 KIAA0895
HPAiHPA021036
HPA061066
neXtProtiNX_Q8NCT3
OpenTargetsiENSG00000164542
PharmGKBiPA164721801

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGSS Eukaryota
ENOG410YKC2 LUCA
GeneTreeiENSGT00390000004417
HOGENOMiHOG000069902
HOVERGENiHBG067127
InParanoidiQ8NCT3
OMAiQPGCFNK
OrthoDBi749754at2759
PhylomeDBiQ8NCT3
TreeFamiTF329621

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIAA0895 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIAA0895

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23366

Protein Ontology

More...
PROi
PR:Q8NCT3

Gene expression databases

BgeeiENSG00000164542 Expressed in 194 organ(s), highest expression level in neocortex
ExpressionAtlasiQ8NCT3 baseline and differential
GenevisibleiQ8NCT3 HS

Family and domain databases

InterProiView protein in InterPro
IPR012548 DUF1704
PANTHERiPTHR31817 PTHR31817, 2 hits
PfamiView protein in Pfam
PF08014 DUF1704, 1 hit
SMARTiView protein in SMART
SM01154 DUF1704, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK0895_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NCT3
Secondary accession number(s): B4DF35
, B7ZLT4, B9EGB9, O94969, Q0VGC1, Q7Z4L2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: January 16, 2019
This is version 103 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again