Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C11orf65

Gene

C11orf65

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C11orf65
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000166323.12
HGNCiHGNC:28519 C11orf65
neXtProtiNX_Q8NCR3

Pathology & Biotechi

Organism-specific databases

DisGeNETi160140
OpenTargetsiENSG00000166323
PharmGKBiPA144596484

Polymorphism and mutation databases

BioMutaiC11orf65
DMDMi74730167

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002636651 – 313Uncharacterized protein C11orf65Add BLAST313

Proteomic databases

PaxDbiQ8NCR3
PeptideAtlasiQ8NCR3
PRIDEiQ8NCR3
ProteomicsDBi72927

PTM databases

iPTMnetiQ8NCR3
PhosphoSitePlusiQ8NCR3

Expressioni

Gene expression databases

BgeeiENSG00000166323
CleanExiHS_C11orf65
ExpressionAtlasiQ8NCR3 baseline and differential
GenevisibleiQ8NCR3 HS

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi127748, 9 interactors
IntActiQ8NCR3, 7 interactors
STRINGi9606.ENSP00000376799

Structurei

3D structure databases

ProteinModelPortaliQ8NCR3
SMRiQ8NCR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IG29 Eukaryota
ENOG410Y50F LUCA
GeneTreeiENSGT00510000048394
HOGENOMiHOG000070185
HOVERGENiHBG054505
InParanoidiQ8NCR3
OMAiNSPRDYT
OrthoDBiEOG091G0EQG
PhylomeDBiQ8NCR3
TreeFamiTF328500

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NCR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPWKEESEFT KQDKAARVIQ QAWKSFLNVA IFQHFKSLID LRRQGEPRQI
60 70 80 90 100
VKYINPKEAE LLDAAAGIHV RFRLGGVKFP PDIYYKIFTH RPIEDLCANS
110 120 130 140 150
PRNYAKLPAK HTSHNKNDHL QEEDHSGWYH RIENNGWRPV SDTFWLSTDG
160 170 180 190 200
MVVEDKKESE FHFSKLKRRQ DLEKKRKLRK IEWMRQMYYS GSLEAKSTHH
210 220 230 240 250
ETLGLIHTAT KGLIRAFEDG GIDSVMEWEV DEVLNWTNTL NFDEYIASWK
260 270 280 290 300
EIATSNSSAN FKGFRFNQAQ KNIYNYGGDI SKMQMGIPDD TYYENVYQEP
310
NVTRLTPDST YGL
Length:313
Mass (Da):36,720
Last modified:October 1, 2002 - v1
Checksum:iF0A4D2DB06B651CB
GO
Isoform 2 (identifier: Q8NCR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-76: Missing.
     264-313: FRFNQAQKNI...RLTPDSTYGL → IFFRILFSIKMEYEEFLSSPTPANVNTILPQW

Note: No experimental confirmation available.
Show »
Length:246
Mass (Da):29,127
Checksum:iF7B901E084EE5B7D
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05688828 – 76Missing in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_056889264 – 313FRFNQ…STYGL → IFFRILFSIKMEYEEFLSSP TPANVNTILPQW in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303096 mRNA Translation: BAG64206.1
AP001925 Genomic DNA No translation available.
AP005718 Genomic DNA No translation available.
BC029536 mRNA Translation: AAH29536.1
CCDSiCCDS81622.1 [Q8NCR3-2]
CCDS8340.1 [Q8NCR3-1]
RefSeqiNP_001317297.1, NM_001330368.1 [Q8NCR3-2]
NP_689800.3, NM_152587.3 [Q8NCR3-1]
XP_011540941.1, XM_011542639.2 [Q8NCR3-1]
XP_016872735.1, XM_017017246.1 [Q8NCR3-1]
UniGeneiHs.653180

Genome annotation databases

EnsembliENST00000393084; ENSP00000376799; ENSG00000166323 [Q8NCR3-1]
ENST00000525729; ENSP00000433395; ENSG00000166323 [Q8NCR3-2]
ENST00000527531; ENSP00000431706; ENSG00000166323 [Q8NCR3-1]
ENST00000529391; ENSP00000436400; ENSG00000166323 [Q8NCR3-1]
ENST00000615746; ENSP00000483537; ENSG00000166323 [Q8NCR3-1]
GeneIDi160140
KEGGihsa:160140
UCSCiuc001pkh.3 human [Q8NCR3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCK065_HUMAN
AccessioniPrimary (citable) accession number: Q8NCR3
Secondary accession number(s): B4DZU4, Q6PCA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: October 1, 2002
Last modified: June 20, 2018
This is version 104 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health