Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (26 Feb 2020)
Sequence version 3 (28 Mar 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein PROCA1

Gene

PROCA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Was originally thought to interact with CCNA1 and found in a complex with CCNA1 and CDK2 (PubMed:15159402). However the amino acid sequence described in this paper contains several frameshifts and a wrong choice of frame, so results from this paper need to be validated.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8NCQ7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein PROCA1Curated
Alternative name(s):
Protein interacting with cyclin A11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PROCA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28600 PROCA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617376 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NCQ7

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000167525

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165432492

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NCQ7 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PROCA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
189037421

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003360631 – 364Protein PROCA1Add BLAST364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei276PhosphoserineBy similarity1
Modified residuei308PhosphoserineBy similarity1
Modified residuei318PhosphoserineBy similarity1
Modified residuei319PhosphoserineBy similarity1
Modified residuei355PhosphoserineBy similarity1
Modified residuei364PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NCQ7

PeptideAtlas

More...
PeptideAtlasi
Q8NCQ7

PRoteomics IDEntifications database

More...
PRIDEi
Q8NCQ7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
34024
72923 [Q8NCQ7-1]
72924 [Q8NCQ7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NCQ7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NCQ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167525 Expressed in right testis and 111 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NCQ7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NCQ7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023648

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127029, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NCQ7, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000301039

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NCQ7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi174 – 182Poly-Glu9
Compositional biasi226 – 272Lys-richAdd BLAST47

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PROCA1 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162235

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NCQ7

Identification of Orthologs from Complete Genome Data

More...
OMAi
FSDCGHH

Database of Orthologous Groups

More...
OrthoDBi
1306595at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NCQ7

TreeFam database of animal gene trees

More...
TreeFami
TF350402

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016090 PLipase_A2_dom
IPR036444 PLipase_A2_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05826 Phospholip_A2_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48619 SSF48619, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NCQ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWVRTTLTIE RWTKEKTEPK ARSWDEALSD VNRLPSWERG HLLAGVASST
60 70 80 90 100
DVSTFSEGGD CKEPDKCCWR HKQCTGHIIY PFASDCVRHS LHLHSVNHCN
110 120 130 140 150
CNSRLKDSSE DSSSSRGAGP TCSHVIESPC FELTPEEEHV ERFRYGWCKS
160 170 180 190 200
YRPVSVAVIH HPLYHECGAD DLNEEEEEEE EESKPPIPTQ VGPATASPDL
210 220 230 240 250
GTSMATGTPD STAPITIWRS ESPTGKGQGS KVIKKVKKKK EKEKDKEEMD
260 270 280 290 300
EKAKLKKKAK KGQLTKKKSP VKLEPSPPDV SRSLSARQLA RMSESSPESR
310 320 330 340 350
EELESEDSYN GRGQGELSSE DIVESSSPRK RENTVQAKKT GAKPSQARKV
360
NKRKSPPGSN PNLS
Length:364
Mass (Da):40,506
Last modified:March 28, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBAED65CDC427C7A3
GO
Isoform 2 (identifier: Q8NCQ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-58: ALSDVNRLPSWERGHLLAGVASSTDVSTFSEG → SRCR

Show »
Length:336
Mass (Da):37,667
Checksum:iFD51D95493576F71
GO
Isoform 3 (identifier: Q8NCQ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MWVRTTLTIERWTKEKTEPKARSWDEALSD → MSITY
     58-58: Missing.

Show »
Length:338
Mass (Da):37,398
Checksum:i2FA2FDEA417FF004
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QQU2J3QQU2_HUMAN
Protein PROCA1
PROCA1
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESJ9K7ESJ9_HUMAN
Protein PROCA1
PROCA1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSA8J3QSA8_HUMAN
Protein PROCA1
PROCA1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAT09159 differs from that shown. Reason: Frameshift.Curated
The sequence AAT09159 differs from that shown. Reason: Frameshift.Curated
The sequence AAT09159 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti89H → Y in BAG63307 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043476245D → A. Corresponds to variant dbSNP:rs1077127Ensembl.1
Natural variantiVAR_043477320E → K. Corresponds to variant dbSNP:rs3744637Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0539311 – 30MWVRT…EALSD → MSITY in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03398827 – 58ALSDV…TFSEG → SRCR in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05393258Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK301868 mRNA Translation: BAG63307.1
AC010761 Genomic DNA No translation available.
CH471159 Genomic DNA Translation: EAW51125.1
CH471159 Genomic DNA Translation: EAW51126.1
BC029574 mRNA Translation: AAH29574.1
AY601916 mRNA Translation: AAT09159.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11239.1 [Q8NCQ7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001291878.1, NM_001304949.1
NP_001291880.1, NM_001304951.1
NP_001291881.1, NM_001304952.1 [Q8NCQ7-3]
NP_001291882.1, NM_001304953.1
NP_001291883.1, NM_001304954.1
NP_689678.1, NM_152465.2 [Q8NCQ7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301039; ENSP00000301039; ENSG00000167525 [Q8NCQ7-2]
ENST00000439862; ENSP00000411400; ENSG00000167525 [Q8NCQ7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
147011

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:147011

UCSC genome browser

More...
UCSCi
uc002hca.2 human [Q8NCQ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301868 mRNA Translation: BAG63307.1
AC010761 Genomic DNA No translation available.
CH471159 Genomic DNA Translation: EAW51125.1
CH471159 Genomic DNA Translation: EAW51126.1
BC029574 mRNA Translation: AAH29574.1
AY601916 mRNA Translation: AAT09159.1 Sequence problems.
CCDSiCCDS11239.1 [Q8NCQ7-2]
RefSeqiNP_001291878.1, NM_001304949.1
NP_001291880.1, NM_001304951.1
NP_001291881.1, NM_001304952.1 [Q8NCQ7-3]
NP_001291882.1, NM_001304953.1
NP_001291883.1, NM_001304954.1
NP_689678.1, NM_152465.2 [Q8NCQ7-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi127029, 2 interactors
IntActiQ8NCQ7, 1 interactor
STRINGi9606.ENSP00000301039

PTM databases

iPTMnetiQ8NCQ7
PhosphoSitePlusiQ8NCQ7

Polymorphism and mutation databases

BioMutaiPROCA1
DMDMi189037421

Proteomic databases

MassIVEiQ8NCQ7
PeptideAtlasiQ8NCQ7
PRIDEiQ8NCQ7
ProteomicsDBi34024
72923 [Q8NCQ7-1]
72924 [Q8NCQ7-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
147011

Genome annotation databases

EnsembliENST00000301039; ENSP00000301039; ENSG00000167525 [Q8NCQ7-2]
ENST00000439862; ENSP00000411400; ENSG00000167525 [Q8NCQ7-1]
GeneIDi147011
KEGGihsa:147011
UCSCiuc002hca.2 human [Q8NCQ7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
147011

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PROCA1
HGNCiHGNC:28600 PROCA1
HPAiHPA023648
MIMi617376 gene
neXtProtiNX_Q8NCQ7
OpenTargetsiENSG00000167525
PharmGKBiPA165432492

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000162235
InParanoidiQ8NCQ7
OMAiFSDCGHH
OrthoDBi1306595at2759
PhylomeDBiQ8NCQ7
TreeFamiTF350402

Enzyme and pathway databases

SignaLinkiQ8NCQ7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PROCA1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
147011
PharosiQ8NCQ7 Tbio

Protein Ontology

More...
PROi
PR:Q8NCQ7
RNActiQ8NCQ7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167525 Expressed in right testis and 111 other tissues
ExpressionAtlasiQ8NCQ7 baseline and differential
GenevisibleiQ8NCQ7 HS

Family and domain databases

Gene3Di1.20.90.10, 1 hit
InterProiView protein in InterPro
IPR016090 PLipase_A2_dom
IPR036444 PLipase_A2_dom_sf
PfamiView protein in Pfam
PF05826 Phospholip_A2_2, 1 hit
SUPFAMiSSF48619 SSF48619, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRCA1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NCQ7
Secondary accession number(s): B4DX95, G5E9R8, Q6PKN3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: March 28, 2018
Last modified: February 26, 2020
This is version 132 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again