Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NCE0 (SEN2_HUMAN)

Entry version 148 (26 Feb 2020)
Sequence version 2 (19 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

tRNA-splicing endonuclease subunit Sen2

Gene

TSEN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Isoform 1 probably carries the active site for 5'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Isoform 2 is responsible for processing a yet unknown RNA substrate. The complex containing isoform 2 is not able to cleave pre-tRNAs properly, although it retains endonucleolytic activity.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • PretRNA = a 3'-half-tRNA molecule with a 5'-OH end + a 5'-half-tRNA molecule with a 2',3'-cyclic phosphate end + an intron with a 2',3'-cyclic phosphate and a 5'-hydroxyl terminus. EC:4.6.1.16

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei369By similarity1
Active sitei377By similarity1
Active sitei416By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processmRNA processing, tRNA processing

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS08007-MONOMER

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6784531 tRNA processing in the nucleus

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
tRNA-splicing endonuclease subunit Sen2 (EC:4.6.1.16)
Alternative name(s):
tRNA-intron endonuclease Sen2
Short name:
HsSen2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSEN2
Synonyms:SEN2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28422 TSEN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608753 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NCE0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pontocerebellar hypoplasia 2B (PCH2B)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by an abnormally small cerebellum and brainstem, and progressive microcephaly from birth combined with extrapyramidal dyskinesia. Severe chorea occurs and epilepsy is frequent. There are no signs of spinal cord anterior horn cells degeneration.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_054810309Y → C in PCH2B. 1 PublicationCorresponds to variant dbSNP:rs113994149EnsemblClinVar.1

Keywords - Diseasei

Neurodegeneration, Pontocerebellar hypoplasia

Organism-specific databases

DisGeNET

More...DisGeNETi		80746

MalaCards human disease database

More...MalaCardsi		TSEN2
MIMi612389 phenotype

Open Targets

More...OpenTargetsi		ENSG00000154743

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2524 Pontocerebellar hypoplasia type 2

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142670695

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NCE0 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TSEN2

Domain mapping of disease mutations (DMDM)

More...DMDMi		50428914

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001094521 – 465tRNA-splicing endonuclease subunit Sen2Add BLAST465

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei408PhosphoserineBy similarity1
Modified residuei411PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8NCE0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NCE0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NCE0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NCE0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8NCE0

PeptideAtlas

More...PeptideAtlasi		Q8NCE0

PRoteomics IDEntifications database

More...PRIDEi		Q8NCE0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		34009
72878 [Q8NCE0-1]
72879 [Q8NCE0-2]
72880 [Q8NCE0-3]
7810

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NCE0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NCE0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are widely expressed at very low level.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000154743 Expressed in buccal mucosa cell and 179 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NCE0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NCE0 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA027120
HPA027125
HPA027268

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

tRNA splicing endonuclease is a heterotetramer composed of isoform 1 of TSEN2, TSEN15, TSEN34/LENG5 and TSEN54. tRNA splicing endonuclease complex also contains proteins of the pre-mRNA 3'-end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2. Isoform 2 belongs to a different complex that contains TSEN54 but low level of TSEN15 and TSEN34/LENG5.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q7Z6J97EBI-2559818,EBI-2559824

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		123288, 34 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8NCE0

Protein interaction database and analysis system

More...IntActi		Q8NCE0, 19 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000284995

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NCE0 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tRNA-intron endonuclease family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4685 Eukaryota
COG1676 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000013266

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_046429_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NCE0

KEGG Orthology (KO)

More...KOi		K15322

Identification of Orthologs from Complete Genome Data

More...OMAi		TFEETFF

Database of Orthologous Groups

More...OrthoDBi		1219366at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NCE0

TreeFam database of animal gene trees

More...TreeFami		TF314679

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.1350.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011856 tRNA_endonuc-like_dom_sf
IPR036167 tRNA_intron_Endo_cat-like_sf
IPR006677 tRNA_intron_Endonuc_cat-like
IPR006678 tRNA_intron_Endonuc_N
IPR006676 tRNA_splic
IPR016589 tRNA_splic_SEN2

The PANTHER Classification System

More...PANTHERi		PTHR21227 PTHR21227, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01974 tRNA_int_endo, 1 hit
PF02778 tRNA_int_endo_N, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF011789 tRNA_splic_SEN2, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53032 SSF53032, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NCE0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAVFHAPK RKRRVYETYE SPLPIPFGQD HGPLKEFKIF RAEMINNNVI 
        60         70         80         90        100
VRNAEDIEQL YGKGYFGKGI LSRSRPSFTI SDPKLVAKWK DMKTNMPIIT 
       110        120        130        140        150
SKRYQHSVEW AAELMRRQGQ DESTVRRILK DYTKPLEHPP VKRNEEAQVH 
       160        170        180        190        200
DKLNSGMVSN MEGTAGGERP SVVNGDSGKS GGVGDPREPL GCLQEGSGCH 
       210        220        230        240        250
PTTESFEKSV REDASPLPHV CCCKQDALIL QRGLHHEDGS QHIGLLHPGD 
       260        270        280        290        300
RGPDHEYVLV EEAECAMSER EAAPNEELVQ RNRLICRRNP YRIFEYLQLS 
       310        320        330        340        350
LEEAFFLVYA LGCLSIYYEK EPLTIVKLWK AFTVVQPTFR TTYMAYHYFR 
       360        370        380        390        400
SKGWVPKVGL KYGTDLLLYR KGPPFYHASY SVIIELVDDH FEGSLRRPLS 
       410        420        430        440        450
WKSLAALSRV SVNVSKELML CYLIKPSTMT DKEMESPECM KRIKVQEVIL 
       460 
SRWVSSRERS DQDDL
Length:465
Mass (Da):53,247
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF523229B05A1345
GO
Isoform 2 (identifier: Q8NCE0-2) [UniParc]FASTAAdd to basket
Also known as: SEN2deltaEx8, DeltaEx8

The sequence of this isoform differs from the canonical sequence as follows:
     304-320: Missing.

Show »
Length:448
Mass (Da):51,265
Checksum:iB616BDFCDA590E32
GO
Isoform 3 (identifier: Q8NCE0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     278-303: Missing.

Show »
Length:439
Mass (Da):49,942
Checksum:i97A9E847199BDE08
GO
Isoform 4 (identifier: Q8NCE0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-231: Missing.

Show »
Length:406
Mass (Da):47,124
Checksum:i61FD06EBE21EEEFD
GO
Isoform 5 (identifier: Q8NCE0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-301: Missing.
     417-465: ELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL → VTQHQLCHWSVT

Show »
Length:402
Mass (Da):45,532
Checksum:i8B231F84B72FA227
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J7Z4C9J7Z4_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN2
378Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C301H7C301_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2Z3H7C2Z3_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN2
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti138H → Q in BAH13287 (PubMed:14702039).Curated1
Sequence conflicti208K → E in BAH13287 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04893141R → H. Corresponds to variant dbSNP:rs12495784EnsemblClinVar.1
Natural variantiVAR_048932126R → H. Corresponds to variant dbSNP:rs33955793EnsemblClinVar.1
Natural variantiVAR_054810309Y → C in PCH2B. 1 PublicationCorresponds to variant dbSNP:rs113994149EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046192173 – 231Missing in isoform 4. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_046193276 – 301Missing in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_010985278 – 303Missing in isoform 3. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_010986304 – 320Missing in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_046194417 – 465ELMLC…DQDDL → VTQHQLCHWSVT in isoform 5. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK074794 mRNA Translation: BAC11213.1
AK300449 mRNA Translation: BAH13287.1
AK225875 mRNA No translation available.
AC018500 Genomic DNA No translation available.
AC090947 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64129.1
BC004178 mRNA Translation: AAH04178.1
BC004211 mRNA Translation: AAH04211.1
BC019582 mRNA Translation: AAH19582.1
BC021975 mRNA Translation: AAH21975.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2611.1 [Q8NCE0-1]
CCDS46757.1 [Q8NCE0-3]
CCDS46758.1 [Q8NCE0-4]

NCBI Reference Sequences

More...RefSeqi		NP_001138864.1, NM_001145392.1 [Q8NCE0-1]
NP_001138865.1, NM_001145393.2 [Q8NCE0-3]
NP_001138866.1, NM_001145394.1 [Q8NCE0-4]
NP_001308206.1, NM_001321277.1 [Q8NCE0-1]
NP_001308207.1, NM_001321278.1
NP_001308208.1, NM_001321279.1 [Q8NCE0-3]
NP_079541.1, NM_025265.3 [Q8NCE0-1]
XP_016862785.1, XM_017007296.1 [Q8NCE0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000284995; ENSP00000284995; ENSG00000154743 [Q8NCE0-1]
ENST00000402228; ENSP00000385976; ENSG00000154743 [Q8NCE0-1]
ENST00000415684; ENSP00000416510; ENSG00000154743 [Q8NCE0-3]
ENST00000444864; ENSP00000407974; ENSG00000154743 [Q8NCE0-5]
ENST00000454502; ENSP00000392029; ENSG00000154743 [Q8NCE0-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		80746

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:80746

UCSC genome browser

More...UCSCi		uc003bwz.4 human [Q8NCE0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074794 mRNA Translation: BAC11213.1
AK300449 mRNA Translation: BAH13287.1
AK225875 mRNA No translation available.
AC018500 Genomic DNA No translation available.
AC090947 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64129.1
BC004178 mRNA Translation: AAH04178.1
BC004211 mRNA Translation: AAH04211.1
BC019582 mRNA Translation: AAH19582.1
BC021975 mRNA Translation: AAH21975.2
CCDSiCCDS2611.1 [Q8NCE0-1]
CCDS46757.1 [Q8NCE0-3]
CCDS46758.1 [Q8NCE0-4]
RefSeqiNP_001138864.1, NM_001145392.1 [Q8NCE0-1]
NP_001138865.1, NM_001145393.2 [Q8NCE0-3]
NP_001138866.1, NM_001145394.1 [Q8NCE0-4]
NP_001308206.1, NM_001321277.1 [Q8NCE0-1]
NP_001308207.1, NM_001321278.1
NP_001308208.1, NM_001321279.1 [Q8NCE0-3]
NP_079541.1, NM_025265.3 [Q8NCE0-1]
XP_016862785.1, XM_017007296.1 [Q8NCE0-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi123288, 34 interactors
CORUMiQ8NCE0
IntActiQ8NCE0, 19 interactors
STRINGi9606.ENSP00000284995

PTM databases

iPTMnetiQ8NCE0
PhosphoSitePlusiQ8NCE0

Polymorphism and mutation databases

BioMutaiTSEN2
DMDMi50428914

Proteomic databases

EPDiQ8NCE0
jPOSTiQ8NCE0
MassIVEiQ8NCE0
MaxQBiQ8NCE0
PaxDbiQ8NCE0
PeptideAtlasiQ8NCE0
PRIDEiQ8NCE0
ProteomicsDBi34009
72878 [Q8NCE0-1]
72879 [Q8NCE0-2]
72880 [Q8NCE0-3]
7810

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		80746

Genome annotation databases

EnsembliENST00000284995; ENSP00000284995; ENSG00000154743 [Q8NCE0-1]
ENST00000402228; ENSP00000385976; ENSG00000154743 [Q8NCE0-1]
ENST00000415684; ENSP00000416510; ENSG00000154743 [Q8NCE0-3]
ENST00000444864; ENSP00000407974; ENSG00000154743 [Q8NCE0-5]
ENST00000454502; ENSP00000392029; ENSG00000154743 [Q8NCE0-4]
GeneIDi80746
KEGGihsa:80746
UCSCiuc003bwz.4 human [Q8NCE0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		80746
DisGeNETi80746

GeneCards: human genes, protein and diseases

More...GeneCardsi		TSEN2
HGNCiHGNC:28422 TSEN2
HPAiHPA027120
HPA027125
HPA027268
MalaCardsiTSEN2
MIMi608753 gene
612389 phenotype
neXtProtiNX_Q8NCE0
OpenTargetsiENSG00000154743
Orphaneti2524 Pontocerebellar hypoplasia type 2
PharmGKBiPA142670695

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4685 Eukaryota
COG1676 LUCA
GeneTreeiENSGT00390000013266
HOGENOMiCLU_046429_1_0_1
InParanoidiQ8NCE0
KOiK15322
OMAiTFEETFF
OrthoDBi1219366at2759
PhylomeDBiQ8NCE0
TreeFamiTF314679

Enzyme and pathway databases

BioCyciMetaCyc:HS08007-MONOMER
ReactomeiR-HSA-6784531 tRNA processing in the nucleus

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TSEN2 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TSEN2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		80746
PharosiQ8NCE0 Tbio

Protein Ontology

More...PROi		PR:Q8NCE0
RNActiQ8NCE0 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000154743 Expressed in buccal mucosa cell and 179 other tissues
ExpressionAtlasiQ8NCE0 baseline and differential
GenevisibleiQ8NCE0 HS

Family and domain databases

Gene3Di3.40.1350.10, 1 hit
InterProiView protein in InterPro
IPR011856 tRNA_endonuc-like_dom_sf
IPR036167 tRNA_intron_Endo_cat-like_sf
IPR006677 tRNA_intron_Endonuc_cat-like
IPR006678 tRNA_intron_Endonuc_N
IPR006676 tRNA_splic
IPR016589 tRNA_splic_SEN2
PANTHERiPTHR21227 PTHR21227, 1 hit
PfamiView protein in Pfam
PF01974 tRNA_int_endo, 1 hit
PF02778 tRNA_int_endo_N, 1 hit
PIRSFiPIRSF011789 tRNA_splic_SEN2, 1 hit
SUPFAMiSSF53032 SSF53032, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEN2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NCE0
Secondary accession number(s): B7Z6K1
, C9IZI7, G5E9Q3, Q8WTW7, Q9BPU7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: February 26, 2020
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again