Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8NC06 (ACBD4_HUMAN)

Entry version 133 (26 Feb 2020)
Sequence version 2 (07 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Acyl-CoA-binding domain-containing protein 4

Gene

ACBD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei69Acyl-CoA1
Binding sitei88Acyl-CoA1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-390918 Peroxisomal lipid metabolism

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acyl-CoA-binding domain-containing protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACBD4
ORF Names:HMFT0700
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:23337 ACBD4

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8NC06

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		79777

Open Targets

More...OpenTargetsi		ENSG00000181513

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134897893

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8NC06 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ACBD4

Domain mapping of disease mutations (DMDM)

More...DMDMi		67460567

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002140321 – 268Acyl-CoA-binding domain-containing protein 4Add BLAST268

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei166PhosphoserineCombined sources1
Modified residuei171PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8NC06

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8NC06

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8NC06

PeptideAtlas

More...PeptideAtlasi		Q8NC06

PRoteomics IDEntifications database

More...PRIDEi		Q8NC06

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		72841 [Q8NC06-1]
72842 [Q8NC06-2]
72843 [Q8NC06-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8NC06

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8NC06

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000181513 Expressed in right lobe of liver and 155 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8NC06 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8NC06 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA051772

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		122878, 8 interactors

Protein interaction database and analysis system

More...IntActi		Q8NC06, 3 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8NC06 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1268
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8NC06

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8NC06

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 101ACBPROSITE-ProRule annotationAdd BLAST90

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni23 – 32Acyl-CoA binding10
Regioni43 – 47Acyl-CoA binding5

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160739

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_034436_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8NC06

Identification of Orthologs from Complete Genome Data

More...OMAi		RRGDSQW

Database of Orthologous Groups

More...OrthoDBi		1546859at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8NC06

TreeFam database of animal gene trees

More...TreeFami		TF319446

Family and domain databases

Conserved Domains Database

More...CDDi		cd00435 ACBP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.80.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00887 ACBP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00689 ACOABINDINGP

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47027 SSF47027, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NC06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT 
        60         70         80         90        100
MGPCLVPRPG FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI 
       110        120        130        140        150
DTVPLGEVAE DMFGYFEPLY QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG 
       160        170        180        190        200
AVSEPPCLPK EPAPPSPESH SPRDLDSEVF CDSLEQLEPE LSSGQHLEES 
       210        220        230        240        250
VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA CRRCRRGCRA 
       260 
WRACPGPLSS LTLSVRLE
Length:268
Mass (Da):30,308
Last modified:June 7, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0F337D89924CDE2E
GO
Isoform 2 (identifier: Q8NC06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR

Show »
Length:305
Mass (Da):34,756
Checksum:i1EB97FF94E682547
GO
Isoform 3 (identifier: Q8NC06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
     260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

Show »
Length:341
Mass (Da):37,786
Checksum:iEFF98088514D8F23
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EM05K7EM05_HUMAN
Acyl-CoA binding domain containing ...
ACBD4 hCG_28074
269Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMH4K7EMH4_HUMAN
Acyl-CoA-binding domain-containing ...
ACBD4
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti166S → G in BAC11403 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055478118P → L. Corresponds to variant dbSNP:rs901754Ensembl.1
Natural variantiVAR_059109242R → G. Corresponds to variant dbSNP:rs16939879Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_014088168 – 191ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_014089192 – 268SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2. 2 PublicationsAdd BLAST77
Alternative sequenceiVSP_014090260 – 268SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3. 2 Publications9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB073387 mRNA Translation: BAD38638.1
AK023384 mRNA Translation: BAB14553.1
AK075104 mRNA Translation: BAC11403.1
CH471178 Genomic DNA Translation: EAW51550.1
CH471178 Genomic DNA Translation: EAW51551.1
CH471178 Genomic DNA Translation: EAW51552.1
BC029164 mRNA Translation: AAH29164.1
BC041143 mRNA Translation: AAH41143.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS42348.1 [Q8NC06-2]
CCDS45710.1 [Q8NC06-3]
CCDS45711.1 [Q8NC06-1]

NCBI Reference Sequences

More...RefSeqi		NP_001129177.1, NM_001135705.2 [Q8NC06-2]
NP_001129178.1, NM_001135706.2 [Q8NC06-3]
NP_001129179.1, NM_001135707.2 [Q8NC06-1]
NP_001308281.1, NM_001321352.1 [Q8NC06-3]
NP_001308282.1, NM_001321353.1 [Q8NC06-3]
NP_078998.1, NM_024722.3 [Q8NC06-2]
XP_016880577.1, XM_017025088.1 [Q8NC06-3]
XP_016880580.1, XM_017025091.1 [Q8NC06-2]
XP_016880581.1, XM_017025092.1 [Q8NC06-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000321854; ENSP00000314440; ENSG00000181513 [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513 [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513 [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513 [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513 [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513 [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513 [Q8NC06-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		79777

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:79777

UCSC genome browser

More...UCSCi		uc002iic.4 human [Q8NC06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB073387 mRNA Translation: BAD38638.1
AK023384 mRNA Translation: BAB14553.1
AK075104 mRNA Translation: BAC11403.1
CH471178 Genomic DNA Translation: EAW51550.1
CH471178 Genomic DNA Translation: EAW51551.1
CH471178 Genomic DNA Translation: EAW51552.1
BC029164 mRNA Translation: AAH29164.1
BC041143 mRNA Translation: AAH41143.1
CCDSiCCDS42348.1 [Q8NC06-2]
CCDS45710.1 [Q8NC06-3]
CCDS45711.1 [Q8NC06-1]
RefSeqiNP_001129177.1, NM_001135705.2 [Q8NC06-2]
NP_001129178.1, NM_001135706.2 [Q8NC06-3]
NP_001129179.1, NM_001135707.2 [Q8NC06-1]
NP_001308281.1, NM_001321352.1 [Q8NC06-3]
NP_001308282.1, NM_001321353.1 [Q8NC06-3]
NP_078998.1, NM_024722.3 [Q8NC06-2]
XP_016880577.1, XM_017025088.1 [Q8NC06-3]
XP_016880580.1, XM_017025091.1 [Q8NC06-2]
XP_016880581.1, XM_017025092.1 [Q8NC06-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
SMRiQ8NC06
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi122878, 8 interactors
IntActiQ8NC06, 3 interactors

PTM databases

iPTMnetiQ8NC06
PhosphoSitePlusiQ8NC06

Polymorphism and mutation databases

BioMutaiACBD4
DMDMi67460567

Proteomic databases

jPOSTiQ8NC06
MassIVEiQ8NC06
MaxQBiQ8NC06
PeptideAtlasiQ8NC06
PRIDEiQ8NC06
ProteomicsDBi72841 [Q8NC06-1]
72842 [Q8NC06-2]
72843 [Q8NC06-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		79777

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513 [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513 [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513 [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513 [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513 [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513 [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513 [Q8NC06-1]
GeneIDi79777
KEGGihsa:79777
UCSCiuc002iic.4 human [Q8NC06-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		79777
DisGeNETi79777

GeneCards: human genes, protein and diseases

More...GeneCardsi		ACBD4
HGNCiHGNC:23337 ACBD4
HPAiHPA051772
neXtProtiNX_Q8NC06
OpenTargetsiENSG00000181513
PharmGKBiPA134897893

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000160739
HOGENOMiCLU_034436_1_0_1
InParanoidiQ8NC06
OMAiRRGDSQW
OrthoDBi1546859at2759
PhylomeDBiQ8NC06
TreeFamiTF319446

Enzyme and pathway databases

ReactomeiR-HSA-390918 Peroxisomal lipid metabolism

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ACBD4 human
EvolutionaryTraceiQ8NC06

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		79777
PharosiQ8NC06 Tdark

Protein Ontology

More...PROi		PR:Q8NC06
RNActiQ8NC06 protein

Gene expression databases

BgeeiENSG00000181513 Expressed in right lobe of liver and 155 other tissues
ExpressionAtlasiQ8NC06 baseline and differential
GenevisibleiQ8NC06 HS

Family and domain databases

CDDicd00435 ACBP, 1 hit
Gene3Di1.20.80.10, 1 hit
InterProiView protein in InterPro
IPR022408 Acyl-CoA-binding_prot_CS
IPR000582 Acyl-CoA-binding_protein
IPR035984 Acyl-CoA-binding_sf
IPR014352 FERM/acyl-CoA-bd_prot_sf
PfamiView protein in Pfam
PF00887 ACBP, 1 hit
PRINTSiPR00689 ACOABINDINGP
SUPFAMiSSF47027 SSF47027, 1 hit
PROSITEiView protein in PROSITE
PS00880 ACB_1, 1 hit
PS51228 ACB_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACBD4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NC06
Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: February 26, 2020
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again