Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-coupled neutral amino acid transporter 9

Gene

SLC38A9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Lysosomal amino acid transporter involved in the activation of mTORC1 in response to amino acids. Probably acts as an amino acid sensor of the Rag GTPases and Ragulator complexes, 2 complexes involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed:25561175, PubMed:25567906). Following activation by amino acids, the Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. SLC38A9 mediates transport of amino acids with low capacity and specificity with a slight preference for polar amino acids, suggesting that it acts as an amino acid sensor instead (PubMed:25561175, PubMed:25567906). The high concentration of arginine in lysosomes suggests that it acts as an arginine sensor (PubMed:25567906).2 Publications

GO - Molecular functioni

  • amino acid transmembrane transporter activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processAmino-acid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1632852 Macroautophagy
R-HSA-165159 mTOR signalling
R-HSA-166208 mTORC1-mediated signalling
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-8943724 Regulation of PTEN gene transcription
SIGNORiQ8NBW4

Protein family/group databases

TCDBi2.A.18.9.1 the amino acid/auxin permease (aaap) family

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-coupled neutral amino acid transporter 9Curated
Alternative name(s):
Solute carrier family 38 member 9Imported
Up-regulated in lung cancer 111 Publication
Gene namesi
Name:SLC38A9Imported
Synonyms:URLC111 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000177058.11
HGNCiHGNC:26907 SLC38A9
MIMi616203 gene
neXtProtiNX_Q8NBW4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 119Cytoplasmic1 PublicationAdd BLAST119
Transmembranei120 – 140Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini141 – 144LumenalCurated4
Transmembranei145 – 165Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini166 – 198CytoplasmicCuratedAdd BLAST33
Transmembranei199 – 219Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini220 – 290LumenalCuratedAdd BLAST71
Transmembranei291 – 311Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini312 – 313CytoplasmicCurated2
Transmembranei314 – 334Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini335 – 358LumenalCuratedAdd BLAST24
Transmembranei359 – 379Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini380 – 392CytoplasmicCuratedAdd BLAST13
Transmembranei393 – 413Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini414 – 440LumenalCuratedAdd BLAST27
Transmembranei441 – 461Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini462 – 477CytoplasmicCuratedAdd BLAST16
Transmembranei478 – 498Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini499 – 509LumenalCuratedAdd BLAST11
Transmembranei510 – 530Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini531 – 540CytoplasmicCurated10
Transmembranei541 – 561Helical; Name=11Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Endosome, Lysosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi38 – 40RPF → AAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication3
Mutagenesisi60H → A: Does not affect association with the Ragulator complex. 1 Publication1
Mutagenesisi68I → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi70 – 73YYSR → AAAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication4
Mutagenesisi71Y → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi74L → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi85 – 87PDH → AAA: Abolishes interaction with the Ragulator and Rag GTPases complexes. 1 Publication3
Mutagenesisi85P → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi90P → A: Abolishes association with the Ragulator complex. 1 Publication1
Mutagenesisi98 – 101YSPL → AAAA: Does not affect interaction with the Ragulator and Rag GTPases complexes. 1 Publication4
Mutagenesisi128N → A: Moderately affects amino acid transport. 1 Publication1

Organism-specific databases

DisGeNETi153129
OpenTargetsiENSG00000177058
PharmGKBiPA162403774

Polymorphism and mutation databases

BioMutaiSLC38A9
DMDMi296452888

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003288401 – 561Sodium-coupled neutral amino acid transporter 9Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi239N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi248N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi266N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi274N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ8NBW4
MaxQBiQ8NBW4
PaxDbiQ8NBW4
PeptideAtlasiQ8NBW4
PRIDEiQ8NBW4
ProteomicsDBi72830
72831 [Q8NBW4-2]

PTM databases

iPTMnetiQ8NBW4
PhosphoSitePlusiQ8NBW4

Expressioni

Gene expression databases

BgeeiENSG00000177058 Expressed in 183 organ(s), highest expression level in secondary oocyte
CleanExiHS_SLC38A9
ExpressionAtlasiQ8NBW4 baseline and differential
GenevisibleiQ8NBW4 HS

Organism-specific databases

HPAiHPA043785

Interactioni

Subunit structurei

Associated component of the Ragulator complex (composed of LAMTOR1, LAMTOR2, LAMTOR3, LAMTOR4 and LAMTOR5). Associated component of the Rag GTPases heterodimers (composed of RRAGA, RRAGB, RRAGC and RRAGD).2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi127480, 21 interactors
DIPiDIP-61480N
IntActiQ8NBW4, 17 interactors
STRINGi9606.ENSP00000316596

Structurei

3D structure databases

ProteinModelPortaliQ8NBW4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The cytosolic N-terminus part of the protein mediates interaction with the Ragulator complex and the Rag GTPases heterodimers.2 Publications

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1305 Eukaryota
COG0814 LUCA
GeneTreeiENSGT00390000005646
HOGENOMiHOG000294102
HOVERGENiHBG106242
InParanoidiQ8NBW4
KOiK14995
OMAiKDCIEQN
OrthoDBiEOG091G04X6
PhylomeDBiQ8NBW4
TreeFamiTF312989

Family and domain databases

InterProiView protein in InterPro
IPR013057 AA_transpt_TM
PfamiView protein in Pfam
PF01490 Aa_trans, 2 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NBW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV
60 70 80 90 100
NHVIQRVSDH ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP
110 120 130 140 150
LGSAYKLQSY TEGYGKNTSL VTIFMIWNTM MGTSILSIPW GIKQAGFTTG
160 170 180 190 200
MCVIILMGLL TLYCCYRVVK SRTMMFSLDT TSWEYPDVCR HYFGSFGQWS
210 220 230 240 250
SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND TDTILSTNNS
260 270 280 290 300
NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL
310 320 330 340 350
PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF
360 370 380 390 400
FVPEIRFQFP QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV
410 420 430 440 450
TLTYLYIGVL VFASFPSPPL SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ
460 470 480 490 500
MMTVYPLLGY LARVQLLGHI FGDIYPSIFH VLILNLIIVG AGVIMACFYP
510 520 530 540 550
NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK LIFHVFIIIL
560
GVANLIVQFF M
Length:561
Mass (Da):63,776
Last modified:May 18, 2010 - v2
Checksum:i0C1A3A136158168A
GO
Isoform 2 (identifier: Q8NBW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF

Note: No experimental confirmation available.
Show »
Length:462
Mass (Da):52,717
Checksum:iFB8344A9CFD7392F
GO
Isoform 3 (identifier: Q8NBW4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI
     318-353: Missing.

Show »
Length:498
Mass (Da):56,542
Checksum:iA54A4DA31CC0B696
GO
Isoform 4 (identifier: Q8NBW4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:498
Mass (Da):56,695
Checksum:iD213355DA1CD5C13
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9Q7D6R9Q7_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
455Annotation score:
E7ESU6E7ESU6_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
131Annotation score:
D6R9X0D6R9X0_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
96Annotation score:
B3KVK8B3KVK8_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9 FLJ90709, hCG_40989
437Annotation score:
D6RHF5D6RHF5_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
397Annotation score:
D6RG31D6RG31_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
187Annotation score:
D6RER8D6RER8_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
102Annotation score:
D6RBB9D6RBB9_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
43Annotation score:
D6RE72D6RE72_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
43Annotation score:
D6RIW7D6RIW7_HUMAN
Sodium-coupled neutral amino acid t...
SLC38A9
26Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAQ19756 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti84A → P in AAH66891 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_042546182S → T3 PublicationsCorresponds to variant dbSNP:rs4865615Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451101 – 63Missing in isoform 4. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0451111 – 37MANMN…DLRSK → MAICILTWRI in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_045112318 – 353Missing in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032815428 – 561NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2. 1 PublicationAdd BLAST134

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075190 mRNA Translation: BAC11460.1
AK127988 mRNA Translation: BAG54613.1
AK301850 mRNA Translation: BAH13566.1
AB105188 mRNA Translation: BAQ19756.1 Different initiation.
AC008784 Genomic DNA No translation available.
AC016632 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54926.1
BC066891 mRNA Translation: AAH66891.1
BC101362 mRNA Translation: AAI01363.1
BX641065 mRNA Translation: CAE46032.1
CCDSiCCDS3968.1 [Q8NBW4-1]
CCDS58947.1 [Q8NBW4-4]
CCDS58948.1 [Q8NBW4-3]
RefSeqiNP_001245215.1, NM_001258286.1 [Q8NBW4-4]
NP_001245216.1, NM_001258287.1 [Q8NBW4-3]
NP_775785.2, NM_173514.3 [Q8NBW4-1]
XP_006714600.1, XM_006714537.2
XP_006714601.1, XM_006714538.3
XP_006714602.1, XM_006714539.3 [Q8NBW4-1]
XP_011541475.1, XM_011543173.1
XP_011541476.1, XM_011543174.1 [Q8NBW4-1]
UniGeneiHs.742101
Hs.745105

Genome annotation databases

EnsembliENST00000318672; ENSP00000316596; ENSG00000177058 [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058 [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058 [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058 [Q8NBW4-4]
GeneIDi153129
KEGGihsa:153129
UCSCiuc003jqd.4 human [Q8NBW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075190 mRNA Translation: BAC11460.1
AK127988 mRNA Translation: BAG54613.1
AK301850 mRNA Translation: BAH13566.1
AB105188 mRNA Translation: BAQ19756.1 Different initiation.
AC008784 Genomic DNA No translation available.
AC016632 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54926.1
BC066891 mRNA Translation: AAH66891.1
BC101362 mRNA Translation: AAI01363.1
BX641065 mRNA Translation: CAE46032.1
CCDSiCCDS3968.1 [Q8NBW4-1]
CCDS58947.1 [Q8NBW4-4]
CCDS58948.1 [Q8NBW4-3]
RefSeqiNP_001245215.1, NM_001258286.1 [Q8NBW4-4]
NP_001245216.1, NM_001258287.1 [Q8NBW4-3]
NP_775785.2, NM_173514.3 [Q8NBW4-1]
XP_006714600.1, XM_006714537.2
XP_006714601.1, XM_006714538.3
XP_006714602.1, XM_006714539.3 [Q8NBW4-1]
XP_011541475.1, XM_011543173.1
XP_011541476.1, XM_011543174.1 [Q8NBW4-1]
UniGeneiHs.742101
Hs.745105

3D structure databases

ProteinModelPortaliQ8NBW4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127480, 21 interactors
DIPiDIP-61480N
IntActiQ8NBW4, 17 interactors
STRINGi9606.ENSP00000316596

Protein family/group databases

TCDBi2.A.18.9.1 the amino acid/auxin permease (aaap) family

PTM databases

iPTMnetiQ8NBW4
PhosphoSitePlusiQ8NBW4

Polymorphism and mutation databases

BioMutaiSLC38A9
DMDMi296452888

Proteomic databases

EPDiQ8NBW4
MaxQBiQ8NBW4
PaxDbiQ8NBW4
PeptideAtlasiQ8NBW4
PRIDEiQ8NBW4
ProteomicsDBi72830
72831 [Q8NBW4-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318672; ENSP00000316596; ENSG00000177058 [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058 [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058 [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058 [Q8NBW4-4]
GeneIDi153129
KEGGihsa:153129
UCSCiuc003jqd.4 human [Q8NBW4-1]

Organism-specific databases

CTDi153129
DisGeNETi153129
EuPathDBiHostDB:ENSG00000177058.11
GeneCardsiSLC38A9
HGNCiHGNC:26907 SLC38A9
HPAiHPA043785
MIMi616203 gene
neXtProtiNX_Q8NBW4
OpenTargetsiENSG00000177058
PharmGKBiPA162403774
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1305 Eukaryota
COG0814 LUCA
GeneTreeiENSGT00390000005646
HOGENOMiHOG000294102
HOVERGENiHBG106242
InParanoidiQ8NBW4
KOiK14995
OMAiKDCIEQN
OrthoDBiEOG091G04X6
PhylomeDBiQ8NBW4
TreeFamiTF312989

Enzyme and pathway databases

ReactomeiR-HSA-1632852 Macroautophagy
R-HSA-165159 mTOR signalling
R-HSA-166208 mTORC1-mediated signalling
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-8943724 Regulation of PTEN gene transcription
SIGNORiQ8NBW4

Miscellaneous databases

ChiTaRSiSLC38A9 human
GenomeRNAii153129
PROiPR:Q8NBW4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000177058 Expressed in 183 organ(s), highest expression level in secondary oocyte
CleanExiHS_SLC38A9
ExpressionAtlasiQ8NBW4 baseline and differential
GenevisibleiQ8NBW4 HS

Family and domain databases

InterProiView protein in InterPro
IPR013057 AA_transpt_TM
PfamiView protein in Pfam
PF01490 Aa_trans, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiS38A9_HUMAN
AccessioniPrimary (citable) accession number: Q8NBW4
Secondary accession number(s): A0A0A8K8P2
, B3KXV1, B7Z7D0, Q0P5S0, Q6MZJ8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 18, 2010
Last modified: September 12, 2018
This is version 127 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again