Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (29 Sep 2021)
Sequence version 3 (29 Sep 2021)
Previous versions | rss
Add a publicationFeedback
Protein

Solute carrier family 4 member 11

Gene

SLC4A11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Multifunctional transporter with an impact in cell morphology and differentiation. In the presence of borate B(OH)4-, acts as a voltage-dependent electrogenic Na+-coupled B(OH)4- cotransporter controlling boron homeostasis (PubMed:15525507).

At early stages of stem cell differentiation, participates in synergy with ITGA5-ITGB1 and ITGAV-ITGB3 integrins and BMPR1A to promote cell adhesion and contractility that drives differentiation toward osteogenic commitment while inhibiting adipogenesis (By similarity).

In the absence of B(OH)4-, acts as a Na+-coupled OH- or H+ permeable channel with implications in cellular redox balance (PubMed:15525507, PubMed:28642546).

Regulates the oxidative stress response in corneal endothelium by enhancing antioxidant defenses and protecting cells from reactive oxygen species (PubMed:28642546).

In response to hypo-osmotic challenge, also acts as water permeable channel at the basolateral cell membrane of corneal endothelial cells and facilitates transendothelial fluid reabsorption in the aqueous humor (PubMed:31273259, PubMed:25007886, PubMed:23813972).

In the presence of ammonia, acts as an electrogenic NH3/H+ cotransporter and may play a role in ammonia transport and reabsorption in renal Henle's loop epithelium (PubMed:27581649).

By similarity6 Publications

Miscellaneous

Isoforms 1 and 5 correspond to alternative translation start site of the same transcript. There is no evidence that isoform 1 is expressed in primary tissues. It is shown that it is not expressed in cornea, however it is strongly expressed upon transfection into HEK-293 cells.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAnion exchange, Ion transport, Symport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NBS3

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.31.4.1, the anion exchanger (ae) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier family 4 member 11
Alternative name(s):
Sodium borate cotransporter 11 Publication
Short name:
NaBC11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC4A11
Synonyms:BTR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16438, SLC4A11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610206, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NBS3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000088836

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 358Cytoplasmic1 PublicationAdd BLAST358
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei359 – 381HelicalSequence analysisAdd BLAST23
Topological domaini382 – 394Extracellular1 PublicationAdd BLAST13
Transmembranei395 – 408HelicalSequence analysisAdd BLAST14
Topological domaini409 – 413Cytoplasmic1 Publication5
Transmembranei414 – 430HelicalSequence analysisAdd BLAST17
Topological domaini431 – 443Extracellular1 PublicationAdd BLAST13
Transmembranei444 – 467HelicalSequence analysisAdd BLAST24
Topological domaini468 – 475Cytoplasmic1 Publication8
Transmembranei476 – 496HelicalSequence analysisAdd BLAST21
Topological domaini497 – 555Extracellular1 PublicationAdd BLAST59
Transmembranei556 – 577HelicalSequence analysisAdd BLAST22
Topological domaini578 – 590Cytoplasmic1 PublicationAdd BLAST13
Transmembranei591 – 612HelicalSequence analysisAdd BLAST22
Topological domaini613 – 640Extracellular1 PublicationAdd BLAST28
Transmembranei641 – 658HelicalSequence analysisAdd BLAST18
Topological domaini659 – 683Cytoplasmic1 PublicationAdd BLAST25
Transmembranei684 – 704HelicalSequence analysisAdd BLAST21
Topological domaini705 – 734Extracellular1 PublicationAdd BLAST30
Transmembranei735 – 759HelicalSequence analysisAdd BLAST25
Topological domaini760 – 765Cytoplasmic1 Publication6
Transmembranei766 – 783HelicalSequence analysisAdd BLAST18
Topological domaini784 – 787Extracellular1 Publication4
Transmembranei788 – 810HelicalSequence analysisAdd BLAST23
Topological domaini811 – 815Cytoplasmic1 Publication5
Transmembranei816 – 832HelicalSequence analysisAdd BLAST17
Topological domaini833 – 836Extracellular1 Publication4
Transmembranei837 – 857HelicalSequence analysisAdd BLAST21
Topological domaini858 – 875Cytoplasmic1 PublicationAdd BLAST18

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Corneal dystrophy and perceptive deafness (CDPD)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn ocular disease characterized by the association of corneal clouding with progressive perceptive hearing loss.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034946197S → P in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909395EnsemblClinVar.1
Natural variantiVAR_034947472R → K in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909393EnsemblClinVar.1
Natural variantiVAR_034951827L → P in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909394EnsemblClinVar.1
Natural variantiVAR_034953840M → V in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909396EnsemblClinVar.1
Corneal endothelial dystrophy (CHED)15 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA congenital corneal dystrophy characterized by thickening and opacification of the cornea, altered morphology of the endothelium, and secretion of an abnormal collagenous layer at the Descemet membrane.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_063713109R → H in CHED; does not facilitate water flux across the plasma membrane; decreases proton flux with or without cotransport of ammonia; does not affect protein processing. 4 PublicationsCorresponds to variant dbSNP:rs1276051624Ensembl.1
Natural variantiVAR_067272127E → K in CHED; affects protein processing; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED2 mutant. 3 PublicationsCorresponds to variant dbSNP:rs1482631297Ensembl.1
Natural variantiVAR_034945144A → T in CHED. 2 PublicationsCorresponds to variant dbSNP:rs752287261EnsemblClinVar.1
Natural variantiVAR_064978193R → W in CHED. 1 PublicationCorresponds to variant dbSNP:rs566507872Ensembl.1
Natural variantiVAR_064979197S → L in CHED. 1 PublicationCorresponds to variant dbSNP:rs759667344Ensembl.1
Natural variantiVAR_064980217R → C in CHED. 1 PublicationCorresponds to variant dbSNP:rs762942751Ensembl.1
Natural variantiVAR_063714253A → V in CHED; affects protein processing and transport to the cell surface. 3 PublicationsCorresponds to variant dbSNP:rs1298347142Ensembl.1
Natural variantiVAR_063715370C → R in CHED; affects protein processing; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED2 mutant. 5 Publications1
Natural variantiVAR_064981378G → R in CHED. 2 PublicationsCorresponds to variant dbSNP:rs780171125Ensembl.1
Natural variantiVAR_064982385T → K in CHED. 1 Publication1
Natural variantiVAR_064983402G → D in CHED. 2 Publications1
Natural variantiVAR_030662448G → D in CHED; affects protein processing and transport to the cell surface. 2 PublicationsCorresponds to variant dbSNP:rs121909389EnsemblClinVar.1
Natural variantiVAR_064984457L → R in CHED. 1 Publication1
Natural variantiVAR_030663473S → L in CHED; affects protein processing and transport to the cell surface. 3 PublicationsCorresponds to variant dbSNP:rs121909388EnsemblClinVar.1
Natural variantiVAR_064985568T → K in CHED. 1 Publication1
Natural variantiVAR_074015659E → A in CHED. 1 PublicationCorresponds to variant dbSNP:rs749826950Ensembl.1
Natural variantiVAR_030664739R → Q in CHED; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED mutant. 5 PublicationsCorresponds to variant dbSNP:rs121909387EnsemblClinVar.1
Natural variantiVAR_063716739R → W in CHED; affects protein processing and folding. 5 PublicationsCorresponds to variant dbSNP:rs757553189EnsemblClinVar.1
Natural variantiVAR_063717757P → L in CHED. 2 PublicationsCorresponds to variant dbSNP:rs1465111896Ensembl.1
Natural variantiVAR_034948788R → H in CHED. 1 PublicationCorresponds to variant dbSNP:rs766567944Ensembl.1
Natural variantiVAR_034949808V → M in CHED; deafness not assessed. 3 PublicationsCorresponds to variant dbSNP:rs757244518Ensembl.1
Natural variantiVAR_034950817T → M in CHED. 1 PublicationCorresponds to variant dbSNP:rs1422526172Ensembl.1
Natural variantiVAR_030665853R → C in CHED; affects protein processing and transport to the cell surface. 4 PublicationsCorresponds to variant dbSNP:rs121909391EnsemblClinVar.1
Natural variantiVAR_034954853R → H in CHED. 1 PublicationCorresponds to variant dbSNP:rs121909392EnsemblClinVar.1
Natural variantiVAR_063718857L → P in CHED. 1 Publication1
Corneal dystrophy, Fuchs endothelial, 4 (FECD4)4 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA corneal disease caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064422151E → D in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs141836046Ensembl.1
Natural variantiVAR_075537224W → S in FECD4; decreases cell surface expression; abolishes functional activity. 1 PublicationCorresponds to variant dbSNP:rs746532062Ensembl.1
Natural variantiVAR_064423266R → P in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 Publication1
Natural variantiVAR_047809383E → K in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 3 PublicationsCorresponds to variant dbSNP:rs267607065EnsemblClinVar.1
Natural variantiVAR_075538418T → I in FECD4; decreases cell surface expression; highly reduces functional activity. 1 Publication1
Natural variantiVAR_075539491V → I in FECD4; slightly decreases cell surface expression; reduces. 1 PublicationCorresponds to variant dbSNP:rs532728316Ensembl.1
Natural variantiVAR_064424510Y → C in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs150571742Ensembl.1
Natural variantiVAR_064425559V → M in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs144734280Ensembl.1
Natural variantiVAR_064426567G → D in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs139078082EnsemblClinVar.1
Natural variantiVAR_047812693G → E in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 2 PublicationsCorresponds to variant dbSNP:rs267607064EnsemblClinVar.1
Natural variantiVAR_064427726G → R in FECD4; interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs143965185EnsemblClinVar.1
Natural variantiVAR_047813738T → M in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 2 PublicationsCorresponds to variant dbSNP:rs267607066EnsemblClinVar.1
Natural variantiVAR_064428818G → S in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs144586846Ensembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi623N → A: Decreases the water flux across the plasma membrane. 1 Publication1

Keywords - Diseasei

Corneal dystrophy, Deafness, Disease variant

Organism-specific databases

DisGeNET

More...
DisGeNETi
83959

MalaCards human disease database

More...
MalaCardsi
SLC4A11
MIMi217400, phenotype
217700, phenotype
613268, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000088836

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
293603, Congenital hereditary endothelial dystrophy type II
1490, Corneal dystrophy-perceptive deafness syndrome
98974, Fuchs endothelial corneal dystrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38139

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NBS3, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC4A11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29611858

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000792361 – 875Solute carrier family 4 member 11Add BLAST875

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi529N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi537N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NBS3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NBS3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NBS3

PeptideAtlas

More...
PeptideAtlasi
Q8NBS3

PRoteomics IDEntifications database

More...
PRIDEi
Q8NBS3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
32378
72815 [Q8NBS3-1]
72816 [Q8NBS3-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8NBS3, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NBS3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NBS3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in kidney, testis, salivary gland, thyroid, trachea and corneal endothelium. Not detected in retina and lymphocytes.2 Publications
Expressed in corneal endothelium (at protein level).1 Publication
The predominant isoform in corneal endothelium (at protein level).1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated upon oxidative stress, as it occurs in cells exposed to tert-butyl hydroperoxide.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000088836, Expressed in nasal cavity epithelium and 155 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NBS3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NBS3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000088836, Tissue enhanced (salivary gland, thyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123832, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NBS3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369399

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NBS3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1172, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154894

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002289_6_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NBS3

Identification of Orthologs from Complete Genome Data

More...
OMAi
YDHNVSS

Database of Orthologous Groups

More...
OrthoDBi
265068at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NBS3

TreeFam database of animal gene trees

More...
TreeFami
TF313630

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.930.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011531, HCO3_transpt_C
IPR003020, HCO3_transpt_euk
IPR016152, PTrfase/Anion_transptr

The PANTHER Classification System

More...
PANTHERi
PTHR11453, PTHR11453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00955, HCO3_cotransp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01231, HCO3TRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55804, SSF55804, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q8NBS3-3) [UniParc]FASTAAdd to basket
Also known as: SLC4A11-C1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAATRRVFH LQPCENSPTM SQNGYFEDSS YYKCDTDDTF EAREEILGDE
60 70 80 90 100
AFDTANSSIV SGESIRFFVN VNLEMQATNT ENEATSGGCV LLHTSRKYLK
110 120 130 140 150
LKNFKEEIRA HRDLDGFLAQ ASIVLNETAT SLDNVLRTML RRFARDPDNN
160 170 180 190 200
EPNCNLDLLM AMLFTDAGAP MRGKVHLLSD TIQGVTATVT GVRYQQSWLC
210 220 230 240 250
IICTMKALQK RHVCISRLVR PQNWGENSCE VRFVILVLAP PKMKSTKTAM
260 270 280 290 300
EVARTFATMF SDIAFRQKLL ETRTEEEFKE ALVHQRQLLT MVSHGPVAPR
310 320 330 340 350
TKERSTVSLP AHRHPEPPKC KDFVPFGKGI REDIARRFPL YPLDFTDGII
360 370 380 390 400
GKNKAVGKYI TTTLFLYFAC LLPTIAFGSL NDENTDGAID VQKTIAGQSI
410 420 430 440 450
GGLLYALFSG QPLVILLTTA PLALYIQVIR VICDDYDLDF NSFYAWTGLW
460 470 480 490 500
NSFFLALYAF FNLSLVMSLF KRSTEEIIAL FISITFVLDA VKGTVKIFWK
510 520 530 540 550
YYYGHYLDDY HTKRTSSLVS LSGLGASLNA SLHTALNASF LASPTELPSA
560 570 580 590 600
THSGQATAVL SLLIMLGTLW LGYTLYQFKK SPYLHPCVRE ILSDCALPIA
610 620 630 640 650
VLAFSLISSH GFREIEMSKF RYNPSESPFA MAQIQSLSLR AVSGAMGLGF
660 670 680 690 700
LLSMLFFIEQ NLVAALVNAP ENRLVKGTAY HWDLLLLAII NTGLSLFGLP
710 720 730 740 750
WIHAAYPHSP LHVRALALVE ERVENGHIYD TIVNVKETRL TSLGASVLVG
760 770 780 790 800
LSLLLLPVPL QWIPKPVLYG LFLYIALTSL DGNQLVQRVA LLLKEQTAYP
810 820 830 840 850
PTHYIRRVPQ RKIHYFTGLQ VLQLLLLCAF GMSSLPYMKM IFPLIMIAMI
860 870
PIRYILLPRI IEAKYLDVMD AEHRP
Length:875
Mass (Da):98,181
Last modified:September 29, 2021 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6BEDDC9939BADF10
GO
Isoform 1 (identifier: Q8NBS3-1) [UniParc]FASTAAdd to basket
Also known as: SLC4A11-B1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     2-14: AAATRRVFHLQPC → SQVGGRGDRCTQEVQGLVHGAGDLSASLA

Show »
Length:891
Mass (Da):99,581
Checksum:i06AC2FED156BF535
GO
Isoform 2 (identifier: Q8NBS3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.

Show »
Length:409
Mass (Da):45,762
Checksum:iA3AED736B90209A7
GO
Isoform 4 (identifier: Q8NBS3-4) [UniParc]FASTAAdd to basket
Also known as: SLC4A11-A1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MAAATRRVFHLQPC → MGVYGPQDRSESEKRDVQRDPPPWHPRREGERPARARSLPLAAAGQGFLRKTWISEH

Show »
Length:918
Mass (Da):103,145
Checksum:iBA314E50D8F6CD48
GO
Isoform 5 (identifier: Q8NBS3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.

Show »
Length:856
Mass (Da):96,070
Checksum:i4646568E31B59477
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GYK6V9GYK6_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11 hCG_39254
574Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7S1A0A2R8Y7S1_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
852Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFD9A0A2R8YFD9_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
837Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4A6A0A2R8Y4A6_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
808Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6X5A0A2R8Y6X5_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXZ2V9GXZ2_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YEG3A0A2R8YEG3_HUMAN
Sodium bicarbonate transporter-like...
SLC4A11
10Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC11536 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti308S → P in BAC11536 (PubMed:14702039).Curated1
Sequence conflicti560L → P in BAG59341 (PubMed:14702039).Curated1
Sequence conflicti668N → S in BAG59140 (PubMed:14702039).Curated1
Sequence conflicti768L → R in AAI10541 (PubMed:15489334).Curated1
Sequence conflicti818G → D in BAG59341 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04780656N → T1 PublicationCorresponds to variant dbSNP:rs778688114Ensembl.1
Natural variantiVAR_04780775M → V1 PublicationCorresponds to variant dbSNP:rs200940928Ensembl.1
Natural variantiVAR_063713109R → H in CHED; does not facilitate water flux across the plasma membrane; decreases proton flux with or without cotransport of ammonia; does not affect protein processing. 4 PublicationsCorresponds to variant dbSNP:rs1276051624Ensembl.1
Natural variantiVAR_067272127E → K in CHED; affects protein processing; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED2 mutant. 3 PublicationsCorresponds to variant dbSNP:rs1482631297Ensembl.1
Natural variantiVAR_034944134N → S. Corresponds to variant dbSNP:rs34520315EnsemblClinVar.1
Natural variantiVAR_034945144A → T in CHED. 2 PublicationsCorresponds to variant dbSNP:rs752287261EnsemblClinVar.1
Natural variantiVAR_064422151E → D in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs141836046Ensembl.1
Natural variantiVAR_064978193R → W in CHED. 1 PublicationCorresponds to variant dbSNP:rs566507872Ensembl.1
Natural variantiVAR_064979197S → L in CHED. 1 PublicationCorresponds to variant dbSNP:rs759667344Ensembl.1
Natural variantiVAR_034946197S → P in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909395EnsemblClinVar.1
Natural variantiVAR_064980217R → C in CHED. 1 PublicationCorresponds to variant dbSNP:rs762942751Ensembl.1
Natural variantiVAR_075537224W → S in FECD4; decreases cell surface expression; abolishes functional activity. 1 PublicationCorresponds to variant dbSNP:rs746532062Ensembl.1
Natural variantiVAR_063714253A → V in CHED; affects protein processing and transport to the cell surface. 3 PublicationsCorresponds to variant dbSNP:rs1298347142Ensembl.1
Natural variantiVAR_064423266R → P in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 Publication1
Natural variantiVAR_047808311A → V1 PublicationCorresponds to variant dbSNP:rs760889152Ensembl.1
Natural variantiVAR_063715370C → R in CHED; affects protein processing; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED2 mutant. 5 Publications1
Natural variantiVAR_064981378G → R in CHED. 2 PublicationsCorresponds to variant dbSNP:rs780171125Ensembl.1
Natural variantiVAR_047809383E → K in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 3 PublicationsCorresponds to variant dbSNP:rs267607065EnsemblClinVar.1
Natural variantiVAR_064982385T → K in CHED. 1 Publication1
Natural variantiVAR_015521392Q → H1 Publication1
Natural variantiVAR_015522393K → N1 Publication1
Natural variantiVAR_064983402G → D in CHED. 2 Publications1
Natural variantiVAR_075538418T → I in FECD4; decreases cell surface expression; highly reduces functional activity. 1 Publication1
Natural variantiVAR_030662448G → D in CHED; affects protein processing and transport to the cell surface. 2 PublicationsCorresponds to variant dbSNP:rs121909389EnsemblClinVar.1
Natural variantiVAR_064984457L → R in CHED. 1 Publication1
Natural variantiVAR_015523467M → T1 Publication1
Natural variantiVAR_034947472R → K in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909393EnsemblClinVar.1
Natural variantiVAR_030663473S → L in CHED; affects protein processing and transport to the cell surface. 3 PublicationsCorresponds to variant dbSNP:rs121909388EnsemblClinVar.1
Natural variantiVAR_075539491V → I in FECD4; slightly decreases cell surface expression; reduces. 1 PublicationCorresponds to variant dbSNP:rs532728316Ensembl.1
Natural variantiVAR_064424510Y → C in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs150571742Ensembl.1
Natural variantiVAR_047810545T → M1 PublicationCorresponds to variant dbSNP:rs755379986Ensembl.1
Natural variantiVAR_047811549S → L1 PublicationCorresponds to variant dbSNP:rs754745672Ensembl.1
Natural variantiVAR_064425559V → M in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs144734280Ensembl.1
Natural variantiVAR_064426567G → D in FECD4; interferes with post-translational processing; the mutant protein localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs139078082EnsemblClinVar.1
Natural variantiVAR_064985568T → K in CHED. 1 Publication1
Natural variantiVAR_074015659E → A in CHED. 1 PublicationCorresponds to variant dbSNP:rs749826950Ensembl.1
Natural variantiVAR_015524692T → A1 PublicationCorresponds to variant dbSNP:rs1180556979Ensembl.1
Natural variantiVAR_047812693G → E in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 2 PublicationsCorresponds to variant dbSNP:rs267607064EnsemblClinVar.1
Natural variantiVAR_064427726G → R in FECD4; interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs143965185EnsemblClinVar.1
Natural variantiVAR_047813738T → M in FECD4; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein does not rescue the cell surface trafficking of FECD4 mutant. 2 PublicationsCorresponds to variant dbSNP:rs267607066EnsemblClinVar.1
Natural variantiVAR_030664739R → Q in CHED; affects protein processing and transport to the cell surface; the mutant protein is retained intracellularly; coexpression with wild-type protein partially rescues the cell surface trafficking of CHED mutant. 5 PublicationsCorresponds to variant dbSNP:rs121909387EnsemblClinVar.1
Natural variantiVAR_063716739R → W in CHED; affects protein processing and folding. 5 PublicationsCorresponds to variant dbSNP:rs757553189EnsemblClinVar.1
Natural variantiVAR_063717757P → L in CHED. 2 PublicationsCorresponds to variant dbSNP:rs1465111896Ensembl.1
Natural variantiVAR_034948788R → H in CHED. 1 PublicationCorresponds to variant dbSNP:rs766567944Ensembl.1
Natural variantiVAR_034949808V → M in CHED; deafness not assessed. 3 PublicationsCorresponds to variant dbSNP:rs757244518Ensembl.1
Natural variantiVAR_034950817T → M in CHED. 1 PublicationCorresponds to variant dbSNP:rs1422526172Ensembl.1
Natural variantiVAR_064428818G → S in FECD4; does not interferes with post-translational processing; the mutant protein partially localizes to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs144586846Ensembl.1
Natural variantiVAR_034951827L → P in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909394EnsemblClinVar.1
Natural variantiVAR_034952832M → I. Corresponds to variant dbSNP:rs34224785EnsemblClinVar.1
Natural variantiVAR_034953840M → V in CDPD. 1 PublicationCorresponds to variant dbSNP:rs121909396EnsemblClinVar.1
Natural variantiVAR_030665853R → C in CHED; affects protein processing and transport to the cell surface. 4 PublicationsCorresponds to variant dbSNP:rs121909391EnsemblClinVar.1
Natural variantiVAR_034954853R → H in CHED. 1 PublicationCorresponds to variant dbSNP:rs121909392EnsemblClinVar.1
Natural variantiVAR_063718857L → P in CHED. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0611061 – 466Missing in isoform 2. 1 PublicationAdd BLAST466
Alternative sequenceiVSP_0611071 – 19Missing in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0611081 – 14MAAAT…HLQPC → MGVYGPQDRSESEKRDVQRD PPPWHPRREGERPARARSLP LAAAGQGFLRKTWISEH in isoform 4. Add BLAST14
Alternative sequenceiVSP_0611092 – 14AAATR…HLQPC → SQVGGRGDRCTQEVQGLVHG AGDLSASLA in isoform 1. Add BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF336127 mRNA Translation: AAK16734.1
AK075303 mRNA Translation: BAC11536.1 Different initiation.
AK296508 mRNA Translation: BAG59140.1
AK296760 mRNA Translation: BAG59341.1
AL109976 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10536.1
BC110540 mRNA Translation: AAI10541.1
BC110541 mRNA Translation: AAI10542.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13052.1 [Q8NBS3-1]
CCDS54445.1 [Q8NBS3-4]
CCDS54446.1 [Q8NBS3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001167560.1, NM_001174089.1 [Q8NBS3-3]
NP_001167561.1, NM_001174090.1 [Q8NBS3-4]
NP_114423.1, NM_032034.3 [Q8NBS3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380056; ENSP00000369396; ENSG00000088836 [Q8NBS3-1]
ENST00000380059; ENSP00000369399; ENSG00000088836 [Q8NBS3-4]
ENST00000642402; ENSP00000493503; ENSG00000088836 [Q8NBS3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83959

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83959

UCSC genome browser

More...
UCSCi
uc002wig.3, human [Q8NBS3-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336127 mRNA Translation: AAK16734.1
AK075303 mRNA Translation: BAC11536.1 Different initiation.
AK296508 mRNA Translation: BAG59140.1
AK296760 mRNA Translation: BAG59341.1
AL109976 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10536.1
BC110540 mRNA Translation: AAI10541.1
BC110541 mRNA Translation: AAI10542.1
CCDSiCCDS13052.1 [Q8NBS3-1]
CCDS54445.1 [Q8NBS3-4]
CCDS54446.1 [Q8NBS3-3]
RefSeqiNP_001167560.1, NM_001174089.1 [Q8NBS3-3]
NP_001167561.1, NM_001174090.1 [Q8NBS3-4]
NP_114423.1, NM_032034.3 [Q8NBS3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi123832, 2 interactors
IntActiQ8NBS3, 1 interactor
STRINGi9606.ENSP00000369399

Protein family/group databases

TCDBi2.A.31.4.1, the anion exchanger (ae) family

PTM databases

GlyGeniQ8NBS3, 2 sites
iPTMnetiQ8NBS3
PhosphoSitePlusiQ8NBS3

Genetic variation databases

BioMutaiSLC4A11
DMDMi29611858

Proteomic databases

MassIVEiQ8NBS3
MaxQBiQ8NBS3
PaxDbiQ8NBS3
PeptideAtlasiQ8NBS3
PRIDEiQ8NBS3
ProteomicsDBi32378
72815 [Q8NBS3-1]
72816 [Q8NBS3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
7351, 111 antibodies

The DNASU plasmid repository

More...
DNASUi
83959

Genome annotation databases

EnsembliENST00000380056; ENSP00000369396; ENSG00000088836 [Q8NBS3-1]
ENST00000380059; ENSP00000369399; ENSG00000088836 [Q8NBS3-4]
ENST00000642402; ENSP00000493503; ENSG00000088836 [Q8NBS3-3]
GeneIDi83959
KEGGihsa:83959
UCSCiuc002wig.3, human [Q8NBS3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83959
DisGeNETi83959

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC4A11
HGNCiHGNC:16438, SLC4A11
HPAiENSG00000088836, Tissue enhanced (salivary gland, thyroid gland)
MalaCardsiSLC4A11
MIMi217400, phenotype
217700, phenotype
610206, gene
613268, phenotype
neXtProtiNX_Q8NBS3
OpenTargetsiENSG00000088836
Orphaneti293603, Congenital hereditary endothelial dystrophy type II
1490, Corneal dystrophy-perceptive deafness syndrome
98974, Fuchs endothelial corneal dystrophy
PharmGKBiPA38139
VEuPathDBiHostDB:ENSG00000088836

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1172, Eukaryota
GeneTreeiENSGT00940000154894
HOGENOMiCLU_002289_6_0_1
InParanoidiQ8NBS3
OMAiYDHNVSS
OrthoDBi265068at2759
PhylomeDBiQ8NBS3
TreeFamiTF313630

Enzyme and pathway databases

PathwayCommonsiQ8NBS3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
83959, 9 hits in 1012 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC4A11, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC4A11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83959
PharosiQ8NBS3, Tbio

Protein Ontology

More...
PROi
PR:Q8NBS3
RNActiQ8NBS3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000088836, Expressed in nasal cavity epithelium and 155 other tissues
ExpressionAtlasiQ8NBS3, baseline and differential
GenevisibleiQ8NBS3, HS

Family and domain databases

Gene3Di3.40.930.10, 1 hit
InterProiView protein in InterPro
IPR011531, HCO3_transpt_C
IPR003020, HCO3_transpt_euk
IPR016152, PTrfase/Anion_transptr
PANTHERiPTHR11453, PTHR11453, 1 hit
PfamiView protein in Pfam
PF00955, HCO3_cotransp, 1 hit
PRINTSiPR01231, HCO3TRNSPORT
SUPFAMiSSF55804, SSF55804, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NBS3
Secondary accession number(s): B4DKC8
, B4DKX9, G3V1M3, Q2TB62, Q2TB63, Q9BXF4, Q9NTW9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2003
Last sequence update: September 29, 2021
Last modified: September 29, 2021
This is version 167 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again