Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (11 Dec 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Glutamine amidotransferase-like class 1 domain-containing protein 1

Gene

GATD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C56.974

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamine amidotransferase-like class 1 domain-containing protein 1Imported
Alternative name(s):
Parkinson disease 7 domain-containing protein 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GATD1Imported
Synonyms:PDDC1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000177225.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26616 GATD1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NB37

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
347862

Open Targets

More...
OpenTargetsi
ENSG00000177225

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671193

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NB37 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GATD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730065

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 38Sequence analysisAdd BLAST38
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000030509439 – 220Glutamine amidotransferase-like class 1 domain-containing protein 1Add BLAST182

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8NB37

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8NB37

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NB37

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8NB37

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NB37

PeptideAtlas

More...
PeptideAtlasi
Q8NB37

PRoteomics IDEntifications database

More...
PRIDEi
Q8NB37

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72724 [Q8NB37-1]
72725 [Q8NB37-2]
72726 [Q8NB37-3]
72727 [Q8NB37-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NB37

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NB37

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000177225 Expressed in 201 organ(s), highest expression level in cerebellar vermis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NB37 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NB37 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008812

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
131495, 48 interactors

Protein interaction database and analysis system

More...
IntActi
Q8NB37, 43 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000321691

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NB37 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NB37

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C56 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHFM Eukaryota
ENOG410XSJZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010778

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000067792

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NB37

Identification of Orthologs from Complete Genome Data

More...
OMAi
KPVCAVG

Database of Orthologous Groups

More...
OrthoDBi
1305649at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NB37

TreeFam database of animal gene trees

More...
TreeFami
TF328533

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.880, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029062 Class_I_gatase-like

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52317 SSF52317, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NB37-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASERLPNRP ACLLVASGAA EGVSAQSFLH CFTMASTAFN LQVATPGGKA
60 70 80 90 100
MEFVDVTESN ARWVQDFRLK AYASPAKLES IDGARYHALL IPSCPGALTD
110 120 130 140 150
LASSGSLARI LQHFHSESKP ICAVGHGVAA LCCATNEDRS WVFDSYSLTG
160 170 180 190 200
PSVCELVRAP GFARLPLVVE DFVKDSGACF SASEPDAVHV VLDRHLVTGQ
210 220
NASSTVPAVQ NLLFLCGSRK
Length:220
Mass (Da):23,298
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i73A49DD9C551D6BD
GO
Isoform 2 (identifier: Q8NB37-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-220: ASEPDAVHVV...NLLFLCGSRK → GAAASCPKAD...PIYQCVFIYP

Show »
Length:250
Mass (Da):26,784
Checksum:iA5491476BB5B23B1
GO
Isoform 3 (identifier: Q8NB37-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-119: GARYHALLIPSCPGALTDLASSGSLARILQHFHSESK → E

Show »
Length:184
Mass (Da):19,539
Checksum:iCD6049BD6804D00B
GO
Isoform 4 (identifier: Q8NB37-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-119: GARYHALLIPSCPGALTDLASSGSLARILQHFHSESK → E
     151-220: PSVCELVRAP...NLLFLCGSRK → GLGLSQEPPP...PACRSWWRTS

Show »
Length:150
Mass (Da):15,912
Checksum:iCF57CAAED35A3321
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PLI5E9PLI5_HUMAN
Glutamine amidotransferase-like cla...
GATD1
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF25H0YF25_HUMAN
Glutamine amidotransferase-like cla...
GATD1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQD8E9PQD8_HUMAN
Glutamine amidotransferase-like cla...
GATD1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YE25H0YE25_HUMAN
Glutamine amidotransferase-like cla...
GATD1
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YER3H0YER3_HUMAN
Glutamine amidotransferase-like cla...
GATD1
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02823183 – 119GARYH…HSESK → E in isoform 3 and isoform 4. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_028232151 – 220PSVCE…CGSRK → GLGLSQEPPPRSRSPLCVSS SGPPASPACRSWWRTS in isoform 4. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_028233182 – 220ASEPD…CGSRK → GAAASCPKADRHWQHFPVEE IFLACGFKVAGLGAAPGWGR GGKQEDRPPEEQRRAGEDFP IYQCVFIYP in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK091602 mRNA Translation: BAC03706.1
AK092816 mRNA Translation: BAC03983.1
AK128653 mRNA Translation: BAC87551.1
BC110868 mRNA Translation: AAI10869.1
BC112145 mRNA Translation: AAI12146.1
BC143420 mRNA Translation: AAI43421.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7713.1 [Q8NB37-1]
CCDS81530.1 [Q8NB37-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001305753.1, NM_001318824.1 [Q8NB37-3]
NP_872418.1, NM_182612.3 [Q8NB37-1]
XP_016873156.1, XM_017017667.1 [Q8NB37-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000319863; ENSP00000321691; ENSG00000177225 [Q8NB37-1]
ENST00000354286; ENSP00000346239; ENSG00000177225 [Q8NB37-3]
ENST00000397472; ENSP00000380612; ENSG00000177225 [Q8NB37-2]
ENST00000524550; ENSP00000431183; ENSG00000177225 [Q8NB37-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
347862

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:347862

UCSC genome browser

More...
UCSCi
uc001lrc.4 human [Q8NB37-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091602 mRNA Translation: BAC03706.1
AK092816 mRNA Translation: BAC03983.1
AK128653 mRNA Translation: BAC87551.1
BC110868 mRNA Translation: AAI10869.1
BC112145 mRNA Translation: AAI12146.1
BC143420 mRNA Translation: AAI43421.1
CCDSiCCDS7713.1 [Q8NB37-1]
CCDS81530.1 [Q8NB37-3]
RefSeqiNP_001305753.1, NM_001318824.1 [Q8NB37-3]
NP_872418.1, NM_182612.3 [Q8NB37-1]
XP_016873156.1, XM_017017667.1 [Q8NB37-4]

3D structure databases

SMRiQ8NB37
ModBaseiSearch...

Protein-protein interaction databases

BioGridi131495, 48 interactors
IntActiQ8NB37, 43 interactors
STRINGi9606.ENSP00000321691

Protein family/group databases

MEROPSiC56.974

PTM databases

iPTMnetiQ8NB37
PhosphoSitePlusiQ8NB37

Polymorphism and mutation databases

BioMutaiGATD1
DMDMi74730065

Proteomic databases

EPDiQ8NB37
jPOSTiQ8NB37
MassIVEiQ8NB37
MaxQBiQ8NB37
PaxDbiQ8NB37
PeptideAtlasiQ8NB37
PRIDEiQ8NB37
ProteomicsDBi72724 [Q8NB37-1]
72725 [Q8NB37-2]
72726 [Q8NB37-3]
72727 [Q8NB37-4]

Genome annotation databases

EnsembliENST00000319863; ENSP00000321691; ENSG00000177225 [Q8NB37-1]
ENST00000354286; ENSP00000346239; ENSG00000177225 [Q8NB37-3]
ENST00000397472; ENSP00000380612; ENSG00000177225 [Q8NB37-2]
ENST00000524550; ENSP00000431183; ENSG00000177225 [Q8NB37-3]
GeneIDi347862
KEGGihsa:347862
UCSCiuc001lrc.4 human [Q8NB37-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
347862
DisGeNETi347862
EuPathDBiHostDB:ENSG00000177225.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GATD1
HGNCiHGNC:26616 GATD1
HPAiHPA008812
neXtProtiNX_Q8NB37
OpenTargetsiENSG00000177225
PharmGKBiPA142671193

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IHFM Eukaryota
ENOG410XSJZ LUCA
GeneTreeiENSGT00390000010778
HOGENOMiHOG000067792
InParanoidiQ8NB37
OMAiKPVCAVG
OrthoDBi1305649at2759
PhylomeDBiQ8NB37
TreeFamiTF328533

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDDC1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
347862
PharosiQ8NB37 Tdark

Protein Ontology

More...
PROi
PR:Q8NB37
RNActiQ8NB37 protein

Gene expression databases

BgeeiENSG00000177225 Expressed in 201 organ(s), highest expression level in cerebellar vermis
ExpressionAtlasiQ8NB37 baseline and differential
GenevisibleiQ8NB37 HS

Family and domain databases

Gene3Di3.40.50.880, 1 hit
InterProiView protein in InterPro
IPR029062 Class_I_gatase-like
SUPFAMiSSF52317 SSF52317, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGALD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NB37
Secondary accession number(s): B7ZKW5
, Q2NL76, Q6ZQY0, Q8NAE0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 1, 2002
Last modified: December 11, 2019
This is version 118 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again