Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (07 Oct 2020)
Sequence version 3 (08 Feb 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Telomere repeats-binding bouquet formation protein 1

Gene

TERB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the MAJIN-TERB1-TERB2 complex, TERB1 probably mediates association with the shelterin/telosome complex via interaction with TERF1, promoting priming telomeric DNA attachment'. Promotes telomere association with the nuclear envelope and deposition of the SUN-KASH/LINC complex. Also recruits cohesin to telomeres to develop structural rigidity.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processMeiosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8NA31

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Telomere repeats-binding bouquet formation protein 1By similarity
Alternative name(s):
Coiled-coil domain-containing protein 79Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TERB1Imported
Synonyms:CCDC79Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000249961.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26675, TERB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617332, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8NA31

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Membrane, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000249961

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8NA31, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TERB1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
322510134

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003201561 – 727Telomere repeats-binding bouquet formation protein 1Add BLAST727

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei648PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CDK. Phosphorylation by CDK takes place in late prophase when the cap exchange is prominent. is important for the stabilization of telomere attachment but dispenable for the cap exchange.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8NA31

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8NA31

PeptideAtlas

More...
PeptideAtlasi
Q8NA31

PRoteomics IDEntifications database

More...
PRIDEi
Q8NA31

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72629 [Q8NA31-1]
72630 [Q8NA31-2]
72631 [Q8NA31-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8NA31

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8NA31

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000249961, Expressed in testis and 82 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8NA31, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8NA31, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000249961, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the MAJIN-TERB1-TERB2 complex, composed of MAJIN, TERB1 and TERB2.

Interacts with TERF1, STAG3 and SUN1.

Interacts (via Myb-like domain) with the cohesin complex; probably mediated via interaction with STAG3.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8NA31, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000463762

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8NA31, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1727
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8NA31

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati101 – 144ARM 1Add BLAST44
Repeati339 – 382ARM 2Add BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini666 – 719Myb-likeAdd BLAST54

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni523 – 662Interaction with TERF1By similarityAdd BLAST140

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili398 – 446Sequence analysisAdd BLAST49

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TERB1 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQER, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005075

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_022991_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8NA31

Identification of Orthologs from Complete Genome Data

More...
OMAi
MDNAFSQ

Database of Orthologous Groups

More...
OrthoDBi
196162at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8NA31

TreeFam database of animal gene trees

More...
TreeFami
TF335845

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR009057, Homeobox-like_sf
IPR001005, SANT/Myb
IPR042359, TERB1

The PANTHER Classification System

More...
PANTHERi
PTHR14014, PTHR14014, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00249, Myb_DNA-binding, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717, SANT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689, SSF46689, 1 hit
SSF48371, SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8NA31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESEDTKKTQ EMKTDLNLLL ECLKYQMDNA FSQKEALVTI HSICQQNSNA
60 70 80 90 100
SVYFREIGGL MFVKNLAKSS EHSMVKEAAL YTLGAIAEKN VYCQQTLCTS
110 120 130 140 150
ELFEDLTWFL SNDSNINLKR MSVYVILVLV SNNRTGQTLV RETGCITVLS
160 170 180 190 200
RLFRTVISKH ELDLSDKNVF QSYQLWSSVC STLCVCVNNP QNDENQMFCC
210 220 230 240 250
SLFPHANEWL KNCTTPEIIR PICSFIGLTL ANNTYVQKYF VSVGGLDVLS
260 270 280 290 300
QVLMQLESDS HETLSSAKLA VVVTKTVDAC IADNPTFGIV LSKYHIVSKL
310 320 330 340 350
LALLLHESLD SGEKFSIMLT LGHCTEDCEE NQYDLFKNNG LPLMIQALTE
360 370 380 390 400
SQNEELNKAA TFVLHNCKKI TEKLSLSLGE YPFDENETQQ LKDISVKENN
410 420 430 440 450
LEEHWRKAKE ILHRIEQLER EGNEEEIQRE NYQDNISSMN ISIQNTWKHL
460 470 480 490 500
HADRIGRGSK AEDEDKSHSR QLQSYKSHGV MSKACTNDDQ MKTPLKSANP
510 520 530 540 550
VHACYRESEQ NKTLYKAKSS CNQNLHEETT FEKNFVSQSS DHVFKHPVHI
560 570 580 590 600
AKNIKQQLPV TDPFTLCSDI INKEVVSFLA TPSCSEMLTY RCSGCIAVEK
610 620 630 640 650
SLNSRNFSKL LHSCPYQCDR HKVIVEAEDR YKSELRKSLI CNKKILLTPR
660 670 680 690 700
RRQRLSNEST TPGGIKKRRI RKNFTEEEVN YLFNGVKKMG NHWNSILWSF
710 720
PFQQGRKAVD LAHKYHKLTK HPTCAAS
Length:727
Mass (Da):83,064
Last modified:February 8, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i266C9F347B9D4966
GO
Isoform 2 (identifier: Q8NA31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     540-550: SDHVFKHPVHI → RSIYIMFRYNK
     551-727: Missing.

Show »
Length:550
Mass (Da):62,827
Checksum:iA2F2DD7C8360FD54
GO
Isoform 3 (identifier: Q8NA31-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     329-371: EENQYDLFKNNGLPLMIQALTESQNEELNKAATFVLHNCKKIT → A
     540-550: SDHVFKHPVHI → RSIYIMFRYNK
     551-727: Missing.

Show »
Length:508
Mass (Da):57,965
Checksum:i98A239099AA8D259
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KSG9J3KSG9_HUMAN
Telomere repeats-binding bouquet fo...
TERB1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A669KAY0A0A669KAY0_HUMAN
Telomere repeats-binding bouquet fo...
TERB1
358Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KT78J3KT78_HUMAN
Telomere repeats-binding bouquet fo...
TERB1
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031613329 – 371EENQY…CKKIT → A in isoform 3. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_031614540 – 550SDHVFKHPVHI → RSIYIMFRYNK in isoform 2 and isoform 3. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_031615551 – 727Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST177

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK093213 mRNA Translation: BAC04098.1
AC044802 Genomic DNA No translation available.
BC126109 mRNA Translation: AAI26110.1

NCBI Reference Sequences

More...
RefSeqi
NP_001129977.1, NM_001136505.1 [Q8NA31-1]
XP_011521306.1, XM_011523004.2
XP_011521307.1, XM_011523005.2 [Q8NA31-1]
XP_011521308.1, XM_011523006.2
XP_011521309.1, XM_011523007.2
XP_011521310.1, XM_011523008.2 [Q8NA31-1]
XP_011521311.1, XM_011523009.2 [Q8NA31-1]
XP_011521320.1, XM_011523018.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313294; ENSP00000464579; ENSG00000249961 [Q8NA31-3]
ENST00000433154; ENSP00000463762; ENSG00000249961 [Q8NA31-1]
ENST00000558713; ENSP00000462883; ENSG00000249961 [Q8NA31-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
283847

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:283847

UCSC genome browser

More...
UCSCi
uc002eqc.2, human [Q8NA31-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093213 mRNA Translation: BAC04098.1
AC044802 Genomic DNA No translation available.
BC126109 mRNA Translation: AAI26110.1
RefSeqiNP_001129977.1, NM_001136505.1 [Q8NA31-1]
XP_011521306.1, XM_011523004.2
XP_011521307.1, XM_011523005.2 [Q8NA31-1]
XP_011521308.1, XM_011523006.2
XP_011521309.1, XM_011523007.2
XP_011521310.1, XM_011523008.2 [Q8NA31-1]
XP_011521311.1, XM_011523009.2 [Q8NA31-1]
XP_011521320.1, XM_011523018.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WIRX-ray2.10C/D642-656[»]
5XUPX-ray2.10C/D644-655[»]
6J07X-ray3.30B590-649[»]
SMRiQ8NA31
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

IntActiQ8NA31, 1 interactor
STRINGi9606.ENSP00000463762

PTM databases

iPTMnetiQ8NA31
PhosphoSitePlusiQ8NA31

Polymorphism and mutation databases

BioMutaiTERB1
DMDMi322510134

Proteomic databases

MassIVEiQ8NA31
PaxDbiQ8NA31
PeptideAtlasiQ8NA31
PRIDEiQ8NA31
ProteomicsDBi72629 [Q8NA31-1]
72630 [Q8NA31-2]
72631 [Q8NA31-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
72088, 43 antibodies

Genome annotation databases

EnsembliENST00000313294; ENSP00000464579; ENSG00000249961 [Q8NA31-3]
ENST00000433154; ENSP00000463762; ENSG00000249961 [Q8NA31-1]
ENST00000558713; ENSP00000462883; ENSG00000249961 [Q8NA31-1]
GeneIDi283847
KEGGihsa:283847
UCSCiuc002eqc.2, human [Q8NA31-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
283847
EuPathDBiHostDB:ENSG00000249961.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TERB1
HGNCiHGNC:26675, TERB1
HPAiENSG00000249961, Tissue enriched (testis)
MIMi617332, gene
neXtProtiNX_Q8NA31
OpenTargetsiENSG00000249961

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QQER, Eukaryota
GeneTreeiENSGT00390000005075
HOGENOMiCLU_022991_1_0_1
InParanoidiQ8NA31
OMAiMDNAFSQ
OrthoDBi196162at2759
PhylomeDBiQ8NA31
TreeFamiTF335845

Enzyme and pathway databases

PathwayCommonsiQ8NA31

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
283847, 0 hits in 119 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TERB1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
283847
PharosiQ8NA31, Tdark

Protein Ontology

More...
PROi
PR:Q8NA31
RNActiQ8NA31, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000249961, Expressed in testis and 82 other tissues
ExpressionAtlasiQ8NA31, baseline and differential
GenevisibleiQ8NA31, HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR009057, Homeobox-like_sf
IPR001005, SANT/Myb
IPR042359, TERB1
PANTHERiPTHR14014, PTHR14014, 1 hit
PfamiView protein in Pfam
PF00249, Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM00717, SANT, 1 hit
SUPFAMiSSF46689, SSF46689, 1 hit
SSF48371, SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTERB1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8NA31
Secondary accession number(s): A0AUW1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 8, 2011
Last modified: October 7, 2020
This is version 127 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again