Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8N9W6 (BOLL_HUMAN)

Entry version 145 (31 Jul 2019)
Sequence version 2 (01 Mar 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein boule-like

Gene

BOLL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, RNA-binding
Biological processDifferentiation, Spermatogenesis, Translation regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein boule-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BOLL
Synonyms:BOULE
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:14273 BOLL

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606165 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N9W6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		66037

Open Targets

More...OpenTargetsi		ENSG00000152430

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25397

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BOLL

Domain mapping of disease mutations (DMDM)

More...DMDMi		44887719

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000814941 – 283Protein boule-likeAdd BLAST283

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N9W6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8N9W6

PeptideAtlas

More...PeptideAtlasi		Q8N9W6

PRoteomics IDEntifications database

More...PRIDEi		Q8N9W6

ProteomicsDB human proteome resource

More...ProteomicsDBi		72599 [Q8N9W6-1]
72600 [Q8N9W6-2]
72601 [Q8N9W6-3]
72602 [Q8N9W6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N9W6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N9W6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis specific. Not expressed in early embryos, primordial germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000152430 Expressed in 57 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8N9W6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N9W6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA018678
HPA048813

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DAZ1 and DAZL.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		122456, 12 interactors

Protein interaction database and analysis system

More...IntActi		Q8N9W6, 39 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000314792

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8N9W6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 110RRMPROSITE-ProRule annotationAdd BLAST78
Domaini160 – 184DAZPROSITE-ProRule annotationAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RRM DAZ family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0118 Eukaryota
COG0724 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063480

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000095250

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N9W6

Database of Orthologous Groups

More...OrthoDBi		1610446at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N9W6

TreeFam database of animal gene trees

More...TreeFami		TF324396

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037366 BOULE/DAZ
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

The PANTHER Classification System

More...PANTHERi		PTHR11176 PTHR11176, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51890 DAZ, 1 hit
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N9W6-1) [UniParc]FASTAAdd to basket
Also known as: BOULE2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQTDSLSPSP NPVSPVPLNN PTSAPRYGTV IPNRIFVGGI DFKTNESDLR 
        60         70         80         90        100
KFFSQYGSVK EVKIVNDRAG VSKGYGFVTF ETQEDAQKIL QEAEKLNYKD 
       110        120        130        140        150
KKLNIGPAIR KQQVGIPRSS IMPAAGTMYL TTSTGYPYTY HNGVAYFHTP 
       160        170        180        190        200
EVTSVPPPWP SRSVCSSPVM VAQPIYQQPA YHYQATTQYL PGQWQWSVPQ 
       210        220        230        240        250
PSASSAPFLY LQPSEVIYQP VEIAQDGGCV PPPLSLMETS VPEPYSDHGV 
       260        270        280 
QATYHQVYAP SAITMPAPVM QPEPIKTVWS IHY
Length:283
Mass (Da):31,301
Last modified:March 1, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7E28E99C116DAA16
GO
Isoform 2 (identifier: Q8N9W6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQTSNQM
     184-184: Q → QGIKQCHTRRWMDSLLPFTKCDE
     277-283: TVWSIHY → CGAFIIKTIGQLYSSSTDFLSNDPCVAEIQLQRTS

Note: No experimental confirmation available.
Show »
Length:339
Mass (Da):37,541
Checksum:i0950CA3F649997E2
GO
Isoform 3 (identifier: Q8N9W6-3) [UniParc]FASTAAdd to basket
Also known as: BOULE1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → METESGPQTSNQM

Show »
Length:295
Mass (Da):32,592
Checksum:i360456CB75934D45
GO
Isoform 4 (identifier: Q8N9W6-4) [UniParc]FASTAAdd to basket
Also known as: BOULE3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQTSNQM

Show »
Length:289
Mass (Da):31,991
Checksum:iC759FF05532FE415
GO
Isoform 5 (identifier: Q8N9W6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MQTDSLSPS → MTELEYPKG
     10-118: Missing.

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,256
Checksum:iEC6F3B84DD2946D6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WD91F8WD91_HUMAN
Protein boule-like
BOLL
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2G3F2Z2G3_HUMAN
Protein boule-like
BOLL
333Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164V → A in BAC04171 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0553821 – 9MQTDSLSPS → MTELEYPKG in isoform 5. 1 Publication9
Alternative sequenceiVSP_0094441M → MQTSNQM in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_0368051M → METESGPQTSNQM in isoform 3. 2 Publications1
Alternative sequenceiVSP_05538310 – 118Missing in isoform 5. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_009445184Q → QGIKQCHTRRWMDSLLPFTK CDE in isoform 2. 1 Publication1
Alternative sequenceiVSP_009446277 – 283TVWSIHY → CGAFIIKTIGQLYSSSTDFL SNDPCVAEIQLQRTS in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF272858 mRNA Translation: AAK58689.1
AM295005 mRNA Translation: CAL25726.1
AK058099 mRNA Translation: BAB71664.1
AK093453 mRNA Translation: BAC04171.1
AK097795 mRNA No translation available.
AK302817 mRNA Translation: BAG64016.1
AC011997 Genomic DNA Translation: AAX93045.1
CH471063 Genomic DNA Translation: EAW70172.1
BC033674 mRNA Translation: AAH33674.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2324.1 [Q8N9W6-3]
CCDS2325.1 [Q8N9W6-1]
CCDS63081.1 [Q8N9W6-5]

NCBI Reference Sequences

More...RefSeqi		NP_001271287.1, NM_001284358.1 [Q8N9W6-5]
NP_001271290.1, NM_001284361.1 [Q8N9W6-2]
NP_001271291.1, NM_001284362.1 [Q8N9W6-4]
NP_149019.1, NM_033030.5 [Q8N9W6-1]
NP_932074.1, NM_197970.2 [Q8N9W6-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000282278; ENSP00000282278; ENSG00000152430 [Q8N9W6-5]
ENST00000321801; ENSP00000314792; ENSG00000152430 [Q8N9W6-3]
ENST00000392296; ENSP00000376116; ENSG00000152430 [Q8N9W6-1]
ENST00000433157; ENSP00000396099; ENSG00000152430 [Q8N9W6-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		66037

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:66037

UCSC genome browser

More...UCSCi		uc002uus.2 human [Q8N9W6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF272858 mRNA Translation: AAK58689.1
AM295005 mRNA Translation: CAL25726.1
AK058099 mRNA Translation: BAB71664.1
AK093453 mRNA Translation: BAC04171.1
AK097795 mRNA No translation available.
AK302817 mRNA Translation: BAG64016.1
AC011997 Genomic DNA Translation: AAX93045.1
CH471063 Genomic DNA Translation: EAW70172.1
BC033674 mRNA Translation: AAH33674.1
CCDSiCCDS2324.1 [Q8N9W6-3]
CCDS2325.1 [Q8N9W6-1]
CCDS63081.1 [Q8N9W6-5]
RefSeqiNP_001271287.1, NM_001284358.1 [Q8N9W6-5]
NP_001271290.1, NM_001284361.1 [Q8N9W6-2]
NP_001271291.1, NM_001284362.1 [Q8N9W6-4]
NP_149019.1, NM_033030.5 [Q8N9W6-1]
NP_932074.1, NM_197970.2 [Q8N9W6-3]

3D structure databases

SMRiQ8N9W6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122456, 12 interactors
IntActiQ8N9W6, 39 interactors
STRINGi9606.ENSP00000314792

PTM databases

iPTMnetiQ8N9W6
PhosphoSitePlusiQ8N9W6

Polymorphism and mutation databases

BioMutaiBOLL
DMDMi44887719

Proteomic databases

jPOSTiQ8N9W6
PaxDbiQ8N9W6
PeptideAtlasiQ8N9W6
PRIDEiQ8N9W6
ProteomicsDBi72599 [Q8N9W6-1]
72600 [Q8N9W6-2]
72601 [Q8N9W6-3]
72602 [Q8N9W6-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		66037
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282278; ENSP00000282278; ENSG00000152430 [Q8N9W6-5]
ENST00000321801; ENSP00000314792; ENSG00000152430 [Q8N9W6-3]
ENST00000392296; ENSP00000376116; ENSG00000152430 [Q8N9W6-1]
ENST00000433157; ENSP00000396099; ENSG00000152430 [Q8N9W6-1]
GeneIDi66037
KEGGihsa:66037
UCSCiuc002uus.2 human [Q8N9W6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		66037
DisGeNETi66037

GeneCards: human genes, protein and diseases

More...GeneCardsi		BOLL
HGNCiHGNC:14273 BOLL
HPAiHPA018678
HPA048813
MIMi606165 gene
neXtProtiNX_Q8N9W6
OpenTargetsiENSG00000152430
PharmGKBiPA25397

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0118 Eukaryota
COG0724 LUCA
GeneTreeiENSGT00530000063480
HOGENOMiHOG000095250
InParanoidiQ8N9W6
OrthoDBi1610446at2759
PhylomeDBiQ8N9W6
TreeFamiTF324396

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BOLL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		66037

Protein Ontology

More...PROi		PR:Q8N9W6

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000152430 Expressed in 57 organ(s), highest expression level in testis
ExpressionAtlasiQ8N9W6 baseline and differential
GenevisibleiQ8N9W6 HS

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR037366 BOULE/DAZ
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PANTHERiPTHR11176 PTHR11176, 1 hit
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS51890 DAZ, 1 hit
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBOLL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N9W6
Secondary accession number(s): B4DZA4
, Q0JW32, Q53T62, Q969U3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2004
Last modified: July 31, 2019
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again