Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (02 Dec 2020)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Activator of 90 kDa heat shock protein ATPase homolog 2

Gene

Ahsa2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Co-chaperone that stimulates HSP90 ATPase activity.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
Biological processStress response

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Activator of 90 kDa heat shock protein ATPase homolog 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ahsa2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1916133, Ahsa2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003156061 – 331Activator of 90 kDa heat shock protein ATPase homolog 2Add BLAST331

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N9S3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N9S3

PRoteomics IDEntifications database

More...
PRIDEi
Q8N9S3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N9S3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N9S3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020288, Expressed in cortical plate and 286 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N9S3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N9S3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
234490, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000020529

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N9S3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N9S3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AHA1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2936, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157344

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_049046_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N9S3

Identification of Orthologs from Complete Genome Data

More...
OMAi
WPDEHYA

Database of Orthologous Groups

More...
OrthoDBi
1548191at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N9S3

TreeFam database of animal gene trees

More...
TreeFami
TF313680

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.15.10.20, 1 hit
3.30.530.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013538, Activator_of_Hsp90_ATPase
IPR036338, Aha1
IPR039981, AHSA-like
IPR015310, AHSA1_N
IPR023393, START-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13009, PTHR13009, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09229, Aha1_N, 1 hit
PF08327, AHSA1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01000, Aha1_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103111, SSF103111, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N9S3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKWGQGDPR WIVEEREDGT NVNNWHWTER DATIWSKGKL RELLVGIAME
60 70 80 90 100
NEAGRCEISE LKQVEGEASC NSRKGKLIFF YEWNIKLAWK GTVKESGAKH
110 120 130 140 150
KGLIEIPSLS EENEINDTEV NVSKKKGDGE ILKDLMRTTG TAKVREALGE
160 170 180 190 200
YLKALKTEFT TGMILPTKAV ATQELTLQRK LNENKLQASP VALGVRIPTV
210 220 230 240 250
ALHLTELFDT TVEQLYSIFT VKELVQKFSK SPAVLEAERG GKFQMFDGNI
260 270 280 290 300
SGEYVELVTN RKIIMKWRCR NWPEEHYATV ELNFVPAPGQ TELQLDCKGV
310 320 330
PVCKEENMKF CWQKQHFEEI KGLLELTAQN A
Length:331
Mass (Da):37,648
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i94C560599937A951
GO
Isoform 2 (identifier: Q8N9S3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Show »
Length:283
Mass (Da):32,016
Checksum:i7C894550ACFAD953
GO
Isoform 3 (identifier: Q8N9S3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-331: EHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA → ALGFFPRTLCNS

Show »
Length:286
Mass (Da):32,439
Checksum:i7E062BDAC2E59257
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AF82A2AF82_MOUSE
Activator of 90 kDa heat shock prot...
Ahsa2
199Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AF81A2AF81_MOUSE
Activator of 90 kDa heat shock prot...
Ahsa2
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6S1R2F6S1R2_MOUSE
Activator of 90 kDa heat shock prot...
Ahsa2
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH38397 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14E → A in AAH52829 (PubMed:15489334).Curated1
Sequence conflicti29E → A in AAH52829 (PubMed:15489334).Curated1
Sequence conflicti42E → G in BAC04256 (PubMed:15449545).Curated1
Sequence conflicti327T → A in AAH38397 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0305721 – 48Missing in isoform 2. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_030573275 – 331EHYAT…TAQNA → ALGFFPRTLCNS in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK093945 mRNA Translation: BAC04256.1
AK035941 mRNA Translation: BAC29251.1
AK137116 mRNA Translation: BAE23240.1
AK154196 mRNA Translation: BAE32431.1
AK155265 mRNA Translation: BAE33153.1
AL672049 Genomic DNA No translation available.
BC038397 mRNA Translation: AAH38397.2 Different initiation.
BC052829 mRNA Translation: AAH52829.1
BC064012 mRNA Translation: AAH64012.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24476.1 [Q8N9S3-1]
CCDS70149.1 [Q8N9S3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001277583.1, NM_001290654.1 [Q8N9S3-2]
NP_001277584.1, NM_001290655.1 [Q8N9S3-3]
NP_765979.3, NM_172391.4 [Q8N9S3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000020529; ENSMUSP00000020529; ENSMUSG00000020288 [Q8N9S3-1]
ENSMUST00000109539; ENSMUSP00000105166; ENSMUSG00000020288 [Q8N9S3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
268390

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:268390

UCSC genome browser

More...
UCSCi
uc007ifb.2, mouse [Q8N9S3-1]
uc056ykb.1, mouse [Q8N9S3-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093945 mRNA Translation: BAC04256.1
AK035941 mRNA Translation: BAC29251.1
AK137116 mRNA Translation: BAE23240.1
AK154196 mRNA Translation: BAE32431.1
AK155265 mRNA Translation: BAE33153.1
AL672049 Genomic DNA No translation available.
BC038397 mRNA Translation: AAH38397.2 Different initiation.
BC052829 mRNA Translation: AAH52829.1
BC064012 mRNA Translation: AAH64012.1
CCDSiCCDS24476.1 [Q8N9S3-1]
CCDS70149.1 [Q8N9S3-2]
RefSeqiNP_001277583.1, NM_001290654.1 [Q8N9S3-2]
NP_001277584.1, NM_001290655.1 [Q8N9S3-3]
NP_765979.3, NM_172391.4 [Q8N9S3-1]

3D structure databases

SMRiQ8N9S3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi234490, 1 interactor
STRINGi10090.ENSMUSP00000020529

PTM databases

iPTMnetiQ8N9S3
PhosphoSitePlusiQ8N9S3

Proteomic databases

EPDiQ8N9S3
PaxDbiQ8N9S3
PRIDEiQ8N9S3

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
268390

Genome annotation databases

EnsembliENSMUST00000020529; ENSMUSP00000020529; ENSMUSG00000020288 [Q8N9S3-1]
ENSMUST00000109539; ENSMUSP00000105166; ENSMUSG00000020288 [Q8N9S3-2]
GeneIDi268390
KEGGimmu:268390
UCSCiuc007ifb.2, mouse [Q8N9S3-1]
uc056ykb.1, mouse [Q8N9S3-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
268390
MGIiMGI:1916133, Ahsa2

Phylogenomic databases

eggNOGiKOG2936, Eukaryota
GeneTreeiENSGT00940000157344
HOGENOMiCLU_049046_0_0_1
InParanoidiQ8N9S3
OMAiWPDEHYA
OrthoDBi1548191at2759
PhylomeDBiQ8N9S3
TreeFamiTF313680

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
268390, 0 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ahsa2, mouse

Protein Ontology

More...
PROi
PR:Q8N9S3
RNActiQ8N9S3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020288, Expressed in cortical plate and 286 other tissues
ExpressionAtlasiQ8N9S3, baseline and differential
GenevisibleiQ8N9S3, MM

Family and domain databases

Gene3Di3.15.10.20, 1 hit
3.30.530.20, 1 hit
InterProiView protein in InterPro
IPR013538, Activator_of_Hsp90_ATPase
IPR036338, Aha1
IPR039981, AHSA-like
IPR015310, AHSA1_N
IPR023393, START-like_dom_sf
PANTHERiPTHR13009, PTHR13009, 1 hit
PfamiView protein in Pfam
PF09229, Aha1_N, 1 hit
PF08327, AHSA1, 1 hit
SMARTiView protein in SMART
SM01000, Aha1_N, 1 hit
SUPFAMiSSF103111, SSF103111, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAHSA2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N9S3
Secondary accession number(s): Q0P626
, Q6P3F2, Q7TMW7, Q8CBI4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: December 2, 2020
This is version 112 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again