Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Exonuclease mut-7 homolog

Gene

EXD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Possesses 3'-5' exoribonuclease activity. Required for 3'-end trimming of AGO1-bound miRNAs (By similarity).By similarity

Cofactori

Mg2+By similarity

GO - Molecular functioni

Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease
LigandMagnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Exonuclease mut-7 homolog (EC:3.1.-.-)
Alternative name(s):
Exonuclease 3'-5' domain-containing protein 3
Gene namesi
Name:EXD3
ORF Names:HBE269
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000187609.15
HGNCiHGNC:26023 EXD3
neXtProtiNX_Q8N9H8
NX_Q9NX53

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi54932
OpenTargetsiENSG00000187609
PharmGKBiPA164719422

Polymorphism and mutation databases

BioMutaiEXD3
DMDMi308153580

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003190591 – 876Exonuclease mut-7 homologAdd BLAST876

Proteomic databases

EPDiQ8N9H8
PaxDbiQ8N9H8
PeptideAtlasiQ8N9H8
PRIDEiQ8N9H8
ProteomicsDBi72535
72536 [Q8N9H8-2]
72537 [Q8N9H8-3]
72538 [Q8N9H8-4]
83041

PTM databases

iPTMnetiQ8N9H8
PhosphoSitePlusiQ8N9H8

Expressioni

Gene expression databases

BgeeiENSG00000187609 Expressed in 164 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ8N9H8 baseline and differential
GenevisibleiQ8N9H8 HS

Organism-specific databases

HPAiHPA047395

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DAZAP2Q150383EBI-750745,EBI-724310

Protein-protein interaction databases

BioGridi120272, 5 interactors
IntActiQ8N9H8, 2 interactors
STRINGi9606.ENSP00000340474

Structurei

3D structure databases

ProteinModelPortaliQ8N9H8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini517 – 5713'-5' exonucleaseAdd BLAST55

Sequence similaritiesi

Belongs to the mut-7 family.Curated

Phylogenomic databases

eggNOGiKOG2207 Eukaryota
ENOG410YV3M LUCA
GeneTreeiENSGT00390000006843
HOVERGENiHBG108161
InParanoidiQ8N9H8
OMAiCSNWANR
OrthoDBiEOG091G04KJ
PhylomeDBiQ8N9H8
TreeFamiTF328546

Family and domain databases

CDDicd06146 mut-7_like_exo, 1 hit
Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR002562 3'-5'_exonuclease_dom
IPR037432 Mut-7_DEDDy_dom
IPR002782 Mut7-C_RNAse_dom
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
PfamiView protein in Pfam
PF01612 DNA_pol_A_exo1, 1 hit
PF01927 Mut7-C, 1 hit
SMARTiView protein in SMART
SM00474 35EXOc, 1 hit
SUPFAMiSSF53098 SSF53098, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N9H8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDPGDPAGDP AAGERHRMGR DPLLLLQALQ TLWSTRERKQ LREEAWRGFA
60 70 80 90 100
ALDDPLAGLL DMLESCRGQR GEGPSLAAWI SHQLQCWLQA QPCPSLAQHS
110 120 130 140 150
LRLKQLQARA VKVLTESPPS LAAPLASIFQ LQDADRSCLL AHVHRLHHEG
160 170 180 190 200
RFREAATLGA TLKLQSELGV EKMSIPLLLQ DKVALVERYV AGFPDLQRRL
210 220 230 240 250
LVLMDSWCQP GFDIKDVARR YPEVTSLSLE KLSPKALSRQ VLRLQERYGV
260 270 280 290 300
APALCPNAAI QQRLAALRHL CHKRFVEKSL SQENWTDHVQ GLVGQSPWLQ
310 320 330 340 350
EQLSQLLVSH SDPVTAAQCA MELLLPEERL PAAVAVELRR FRLQGRATEA
360 370 380 390 400
DSRLEVKDMK DRYYQLPIPR ENVHLLASWE DLTRHEGALL QCHQVVGVDV
410 420 430 440 450
EWTPVFVAGG RPRPSLLQVA VEGHVFLLDV LALSQPPTGQ GAQAFSRLVA
460 470 480 490 500
QLLSDPSITK LGYGMVGDLQ KLGTSCPALA HVEKQILGGM DLLLVHRQMR
510 520 530 540 550
VASVPAPAVD RARELRGLSL LVQQVLGTAL DKTQQLSNWD RRPLCEEQVI
560 570 580 590 600
YAAADAYCLL EVHQALCREP ARFHLSEDLA GSRRPRHRER PGARKPPGLQ
610 620 630 640 650
KASAPAAPRQ VPVAVAVSEG AAPQIPARAF RVVCDNMLQG LARSLRCLGV
660 670 680 690 700
DARMLGNGED HRRAAEVARQ EGRIILTSGQ PFHKLRAQVG AGRCLSVDCS
710 720 730 740 750
LKAQQQAKAV LKHFNVRVTH ADIFSRCQAC NCDQYLKVSR DMMKQLMWLS
760 770 780 790 800
SHQEGPRSSG DEATQSQAVQ EPGPAPDAAP EGCTYDRPCR WLQMADLRAE
810 820 830 840 850
TPDMLADGTR LQLAGVPVGV LRTPGLRCFY CCTGCGKVFW DGSHLGRVAT
860 870
HFRDMLESAP SPCEPSPAPS PASSPF
Length:876
Mass (Da):96,598
Last modified:October 5, 2010 - v3
Checksum:iA9033CFCDE2D1B0D
GO
Isoform 2 (identifier: Q8N9H8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-277: Missing.
     278-289: KSLSQENWTDHV → MSPSPSSRPPSS

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):65,379
Checksum:i5C7EFE9C39C20E5F
GO
Isoform 3 (identifier: Q8N9H8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-320: Missing.
     610-638: Missing.
     760-772: Missing.

Note: No experimental confirmation available.
Show »
Length:514
Mass (Da):56,574
Checksum:i6B3CB08118787AAE
GO
Isoform 4 (identifier: Q8N9H8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-246: RRYPEVTSLSLEKLSPKALSRQVLRLQE → SCHVTAAGAAASGEERLGLAGAQPSSPE
     247-876: Missing.

Show »
Length:246
Mass (Da):26,852
Checksum:i2A1516725BC6A7CE
GO
Isoform 5 (identifier: Q8N9H8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-56: RDPLLLLQALQTLWSTRERKQLREEAWRGFAALDDPL → THRLLQPLLHLSRVGCFQSATPQLAGPLEQPRRPLEH
     57-876: Missing.

Show »
Length:56
Mass (Da):6,117
Checksum:i49EEEFCA3FF87B7A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PSB6E9PSB6_HUMAN
Exonuclease mut-7 homolog
EXD3
140Annotation score:
E9PI94E9PI94_HUMAN
Exonuclease mut-7 homolog
EXD3
40Annotation score:
H0YD51H0YD51_HUMAN
Exonuclease mut-7 homolog
EXD3
36Annotation score:

Sequence cautioni

The sequence AAH39252 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAH65002 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAA91167 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAC04356 differs from that shown. Reason: Erroneous termination at position 759. Translated as Ser.Curated
The sequence EAW88381 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti105Q → R in BAC10986 (Ref. 1) Curated1
Sequence conflicti105Q → R in BAB70838 (PubMed:14702039).Curated1
Sequence conflicti105Q → R in BAC04356 (PubMed:14702039).Curated1
Sequence conflicti160A → T in BAC04356 (PubMed:14702039).Curated1
Sequence conflicti160A → T in AAH37355 (PubMed:15489334).Curated1
Sequence conflicti160A → T in AAI10880 (PubMed:15489334).Curated1
Sequence conflicti249G → S in BAC04356 (PubMed:14702039).Curated1
Sequence conflicti322E → D in BAC10986 (Ref. 1) Curated1
Sequence conflicti322E → D in BAC04356 (PubMed:14702039).Curated1
Sequence conflicti322E → D in BAB70838 (PubMed:14702039).Curated1
Sequence conflicti519S → T in BAC10986 (Ref. 1) Curated1
Sequence conflicti545C → Y in BAC10986 (Ref. 1) Curated1
Sequence conflicti545C → Y in BAC04356 (PubMed:14702039).Curated1
Sequence conflicti545C → Y in BAB70838 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06222520R → Q1 PublicationCorresponds to variant dbSNP:rs13291830Ensembl.1
Natural variantiVAR_038945220R → Q1 PublicationCorresponds to variant dbSNP:rs7389423Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0313441 – 320Missing in isoform 3. 1 PublicationAdd BLAST320
Alternative sequenceiVSP_0313451 – 277Missing in isoform 2. 1 PublicationAdd BLAST277
Alternative sequenceiVSP_05936120 – 56RDPLL…LDDPL → THRLLQPLLHLSRVGCFQSA TPQLAGPLEQPRRPLEH in isoform 5. Add BLAST37
Alternative sequenceiVSP_05936257 – 876Missing in isoform 5. Add BLAST820
Alternative sequenceiVSP_031346219 – 246RRYPE…LRLQE → SCHVTAAGAAASGEERLGLA GAQPSSPE in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_031347247 – 876Missing in isoform 4. 1 PublicationAdd BLAST630
Alternative sequenceiVSP_031348278 – 289KSLSQ…WTDHV → MSPSPSSRPPSS in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_031349610 – 638Missing in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_031350760 – 772Missing in isoform 3. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB061798 mRNA Translation: BAC10986.1
HM005438 mRNA Translation: AEE61036.1
AK000440 mRNA Translation: BAA91167.1 Sequence problems.
AK055004 mRNA Translation: BAB70838.1
AK094438 mRNA Translation: BAC04356.1 Sequence problems.
BX322799 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88381.1 Sequence problems.
BC037355 mRNA Translation: AAH37355.1
BC039252 mRNA Translation: AAH39252.2 Sequence problems.
BC065002 mRNA Translation: AAH65002.1 Sequence problems.
BC110879 mRNA Translation: AAI10880.1
CCDSiCCDS48066.1 [Q8N9H8-1]
CCDS75942.1 [Q8N9H8-4]
RefSeqiNP_001273752.1, NM_001286823.1 [Q8N9H8-4]
NP_060290.3, NM_017820.4 [Q8N9H8-1]
UniGeneiHs.495553
Hs.721419

Genome annotation databases

EnsembliENST00000340951; ENSP00000340474; ENSG00000187609 [Q8N9H8-1]
ENST00000465160; ENSP00000432895; ENSG00000187609 [Q8N9H8-5]
ENST00000479452; ENSP00000431859; ENSG00000187609 [Q8N9H8-4]
GeneIDi54932
KEGGihsa:54932
UCSCiuc004cmp.4 human [Q8N9H8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB061798 mRNA Translation: BAC10986.1
HM005438 mRNA Translation: AEE61036.1
AK000440 mRNA Translation: BAA91167.1 Sequence problems.
AK055004 mRNA Translation: BAB70838.1
AK094438 mRNA Translation: BAC04356.1 Sequence problems.
BX322799 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW88381.1 Sequence problems.
BC037355 mRNA Translation: AAH37355.1
BC039252 mRNA Translation: AAH39252.2 Sequence problems.
BC065002 mRNA Translation: AAH65002.1 Sequence problems.
BC110879 mRNA Translation: AAI10880.1
CCDSiCCDS48066.1 [Q8N9H8-1]
CCDS75942.1 [Q8N9H8-4]
RefSeqiNP_001273752.1, NM_001286823.1 [Q8N9H8-4]
NP_060290.3, NM_017820.4 [Q8N9H8-1]
UniGeneiHs.495553
Hs.721419

3D structure databases

ProteinModelPortaliQ8N9H8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120272, 5 interactors
IntActiQ8N9H8, 2 interactors
STRINGi9606.ENSP00000340474

PTM databases

iPTMnetiQ8N9H8
PhosphoSitePlusiQ8N9H8

Polymorphism and mutation databases

BioMutaiEXD3
DMDMi308153580

Proteomic databases

EPDiQ8N9H8
PaxDbiQ8N9H8
PeptideAtlasiQ8N9H8
PRIDEiQ8N9H8
ProteomicsDBi72535
72536 [Q8N9H8-2]
72537 [Q8N9H8-3]
72538 [Q8N9H8-4]
83041

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340951; ENSP00000340474; ENSG00000187609 [Q8N9H8-1]
ENST00000465160; ENSP00000432895; ENSG00000187609 [Q8N9H8-5]
ENST00000479452; ENSP00000431859; ENSG00000187609 [Q8N9H8-4]
GeneIDi54932
KEGGihsa:54932
UCSCiuc004cmp.4 human [Q8N9H8-1]

Organism-specific databases

CTDi54932
DisGeNETi54932
EuPathDBiHostDB:ENSG00000187609.15
GeneCardsiEXD3
HGNCiHGNC:26023 EXD3
HPAiHPA047395
neXtProtiNX_Q8N9H8
NX_Q9NX53
OpenTargetsiENSG00000187609
PharmGKBiPA164719422
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2207 Eukaryota
ENOG410YV3M LUCA
GeneTreeiENSGT00390000006843
HOVERGENiHBG108161
InParanoidiQ8N9H8
OMAiCSNWANR
OrthoDBiEOG091G04KJ
PhylomeDBiQ8N9H8
TreeFamiTF328546

Miscellaneous databases

ChiTaRSiEXD3 human
GenomeRNAii54932
PROiPR:Q8N9H8

Gene expression databases

BgeeiENSG00000187609 Expressed in 164 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ8N9H8 baseline and differential
GenevisibleiQ8N9H8 HS

Family and domain databases

CDDicd06146 mut-7_like_exo, 1 hit
Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR002562 3'-5'_exonuclease_dom
IPR037432 Mut-7_DEDDy_dom
IPR002782 Mut7-C_RNAse_dom
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
PfamiView protein in Pfam
PF01612 DNA_pol_A_exo1, 1 hit
PF01927 Mut7-C, 1 hit
SMARTiView protein in SMART
SM00474 35EXOc, 1 hit
SUPFAMiSSF53098 SSF53098, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMUT7_HUMAN
AccessioniPrimary (citable) accession number: Q8N9H8
Secondary accession number(s): A0A140VJP9
, B8A4U7, C9JIQ9, E9PN82, Q2TAK4, Q6P1M1, Q8IXT8, Q8N3X4, Q8NHD1, Q96NP1, Q9NX53
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: October 5, 2010
Last modified: September 12, 2018
This is version 127 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again