Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative uncharacterized protein C8orf31

Gene

C8orf31

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein uncertaini

Functioni

Caution

Product of a dubious gene prediction. Could be the product of a long non-coding RNA.Curated

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein C8orf31
Gene namesi
Name:C8orf31
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:26731 C8orf31
neXtProtiNX_Q8N9H6

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672350

Polymorphism and mutation databases

BioMutaiC8orf31
DMDMi74729689

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002942381 – 132Putative uncharacterized protein C8orf31Add BLAST132

Proteomic databases

PaxDbiQ8N9H6
PRIDEiQ8N9H6
ProteomicsDBi72533
72534 [Q8N9H6-2]

Expressioni

Gene expression databases

CleanExiHS_C8orf31

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000378601

Structurei

3D structure databases

ProteinModelPortaliQ8N9H6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410JM7P Eukaryota
ENOG411130E LUCA
HOGENOMiHOG000111612
InParanoidiQ8N9H6
PhylomeDBiQ8N9H6
TreeFamiTF341644

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N9H6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEKPHQNSC NSVRQLFKTK QLVTHRDRGS CTHRAQGLLA ARTTALQRSP
60 70 80 90 100
LQQEIWESTT ALNLPSALAP QGLTAKDAHF LGDTDPIQEG ARDHAAGGPF
110 120 130
QDRQASVAAQ TLSWERGQGF SRHHGNHLLY SH
Length:132
Mass (Da):14,527
Last modified:October 1, 2002 - v1
Checksum:i58651E29C8F94717
GO
Isoform 2 (identifier: Q8N9H6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-34: Missing.
     66-132: SALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH → GR

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:62
Mass (Da):6,984
Checksum:iBC679DD475909744
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63N → V in AAH73830 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03315039L → P. Corresponds to variant dbSNP:rs11136300Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02661030 – 34Missing in isoform 2. 1 Publication5
Alternative sequenceiVSP_02661166 – 132SALAP…LLYSH → GR in isoform 2. 1 PublicationAdd BLAST67

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094450 mRNA Translation: BAC04358.1
BC073830 mRNA Translation: AAH73830.1
RefSeqiNP_775958.1, NM_173687.3
UniGeneiHs.660382

Genome annotation databases

UCSCiuc064rsl.1 human [Q8N9H6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Entry informationi

Entry nameiCH031_HUMAN
AccessioniPrimary (citable) accession number: Q8N9H6
Secondary accession number(s): Q6GMU7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: October 1, 2002
Last modified: September 12, 2018
This is version 89 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again