Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (16 Oct 2019)
Sequence version 2 (03 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lysophospholipase D GDPD1

Gene

GDPD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines. Shows a preference for 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF), lysophosphatidylethanolamine (lyso-PE) and lysophosphatidylcholine (lyso-PC). May be involved in bioactive N-acylethanolamine biosynthesis. Does not display glycerophosphodiester phosphodiesterase activity, since it cannot hydrolyze either glycerophosphoinositol or glycerophosphocholine.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi72Divalent metal cationSequence analysis1
Metal bindingi74Divalent metal cationSequence analysis1
Metal bindingi87Divalent metal cationSequence analysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandMetal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.46 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6814848 Glycerophospholipid catabolism

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001718

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysophospholipase D GDPD1Curated (EC:3.1.4.39By similarity)
Alternative name(s):
Glycerophosphodiester phosphodiesterase 41 Publication
Glycerophosphodiester phosphodiesterase domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GDPD1Imported
Synonyms:GDE4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20883 GDPD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616317 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N9F7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 3ExtracellularSequence analysis3
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 195CytoplasmicSequence analysisAdd BLAST171
Transmembranei196 – 216HelicalSequence analysisAdd BLAST21
Topological domaini217 – 314ExtracellularSequence analysisAdd BLAST98

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000153982

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134879258

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N9F7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GDPD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
115502208

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002519311 – 314Lysophospholipase D GDPD1Add BLAST314

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N9F7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N9F7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N9F7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N9F7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N9F7

PeptideAtlas

More...
PeptideAtlasi
Q8N9F7

PRoteomics IDEntifications database

More...
PRIDEi
Q8N9F7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72526 [Q8N9F7-1]
72527 [Q8N9F7-2]
72528 [Q8N9F7-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8N9F7-2 [Q8N9F7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N9F7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N9F7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with high expression level in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000153982 Expressed in 162 organ(s), highest expression level in primary visual cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N9F7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N9F7 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129776, 28 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N9F7, 28 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000284116

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N9F7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 309GP-PDEAdd BLAST270

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2258 Eukaryota
COG0584 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156673

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008170

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N9F7

KEGG Orthology (KO)

More...
KOi
K22387

Identification of Orthologs from Complete Genome Data

More...
OMAi
VHVWTID

Database of Orthologous Groups

More...
OrthoDBi
1143305at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N9F7

TreeFam database of animal gene trees

More...
TreeFami
TF328545

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030395 GP_PDE_dom
IPR017946 PLC-like_Pdiesterase_TIM-brl

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03009 GDPD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51695 SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51704 GP_PDE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N9F7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSTAAFYLL STLGGYLVTS FLLLKYPTLL HQRKKQRFLS KHISHRGGAG
60 70 80 90 100
ENLENTMAAF QHAVKIGTDM LELDCHITKD EQVVVSHDEN LKRATGVNVN
110 120 130 140 150
ISDLKYCELP PYLGKLDVSF QRACQCEGKD NRIPLLKEVF EAFPNTPINI
160 170 180 190 200
DIKVNNNVLI KKVSELVKRY NREHLTVWGN ANYEIVEKCY KENSDIPILF
210 220 230 240 250
SLQRVLLILG LFFTGLLPFV PIREQFFEIP MPSIILKLKE PHTMSRSQKF
260 270 280 290 300
LIWLSDLLLM RKALFDHLTA RGIQVYIWVL NEEQEYKRAF DLGATGVMTD
310
YPTKLRDFLH NFSA
Length:314
Mass (Da):36,167
Last modified:October 3, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8666D98E3A8084A9
GO
Isoform 2 (identifier: Q8N9F7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-290: YIWVLNEEQEYKRAF → SFWNDAFWKQHSSPV
     291-314: Missing.

Show »
Length:290
Mass (Da):33,363
Checksum:i554A9A22DC5DB5E2
GO
Isoform 3 (identifier: Q8N9F7-3) [UniParc]FASTAAdd to basket
Also known as: UGPQ

The sequence of this isoform differs from the canonical sequence as follows:
     266-314: DHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLHNFSA → EPLHPASKRNFEGHCSYLVVSCYF

Show »
Length:289
Mass (Da):33,220
Checksum:i17C52044B21A4A69
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QQN7J3QQN7_HUMAN
Lysophospholipase D GDPD1
GDPD1
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTA9J3KTA9_HUMAN
Lysophospholipase D GDPD1
GDPD1
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRR6J3QRR6_HUMAN
Lysophospholipase D GDPD1
GDPD1
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti70M → T in BAC04419 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_020806266 – 314DHLTA…HNFSA → EPLHPASKRNFEGHCSYLVV SCYF in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_020807276 – 290YIWVL…YKRAF → SFWNDAFWKQHSSPV in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_020808291 – 314Missing in isoform 2. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY271346 mRNA Translation: AAQ01751.1
EU192951 mRNA Translation: ABW73991.1
AK094770 mRNA Translation: BAC04419.1
AC091059 Genomic DNA No translation available.
AC099850 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94412.1
BC034432 mRNA Translation: AAH34432.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11616.1 [Q8N9F7-1]
CCDS58583.1 [Q8N9F7-3]
CCDS58584.1 [Q8N9F7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001159465.1, NM_001165993.1 [Q8N9F7-3]
NP_001159466.1, NM_001165994.1 [Q8N9F7-2]
NP_872375.2, NM_182569.3 [Q8N9F7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000284116; ENSP00000284116; ENSG00000153982 [Q8N9F7-1]
ENST00000581140; ENSP00000463273; ENSG00000153982 [Q8N9F7-3]
ENST00000581276; ENSP00000464690; ENSG00000153982 [Q8N9F7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
284161

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:284161

UCSC genome browser

More...
UCSCi
uc002ixj.4 human [Q8N9F7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY271346 mRNA Translation: AAQ01751.1
EU192951 mRNA Translation: ABW73991.1
AK094770 mRNA Translation: BAC04419.1
AC091059 Genomic DNA No translation available.
AC099850 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94412.1
BC034432 mRNA Translation: AAH34432.1
CCDSiCCDS11616.1 [Q8N9F7-1]
CCDS58583.1 [Q8N9F7-3]
CCDS58584.1 [Q8N9F7-2]
RefSeqiNP_001159465.1, NM_001165993.1 [Q8N9F7-3]
NP_001159466.1, NM_001165994.1 [Q8N9F7-2]
NP_872375.2, NM_182569.3 [Q8N9F7-1]

3D structure databases

SMRiQ8N9F7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi129776, 28 interactors
IntActiQ8N9F7, 28 interactors
STRINGi9606.ENSP00000284116

Chemistry databases

SwissLipidsiSLP:000001718

PTM databases

iPTMnetiQ8N9F7
PhosphoSitePlusiQ8N9F7

Polymorphism and mutation databases

BioMutaiGDPD1
DMDMi115502208

Proteomic databases

EPDiQ8N9F7
jPOSTiQ8N9F7
MassIVEiQ8N9F7
MaxQBiQ8N9F7
PaxDbiQ8N9F7
PeptideAtlasiQ8N9F7
PRIDEiQ8N9F7
ProteomicsDBi72526 [Q8N9F7-1]
72527 [Q8N9F7-2]
72528 [Q8N9F7-3]
TopDownProteomicsiQ8N9F7-2 [Q8N9F7-2]

Genome annotation databases

EnsembliENST00000284116; ENSP00000284116; ENSG00000153982 [Q8N9F7-1]
ENST00000581140; ENSP00000463273; ENSG00000153982 [Q8N9F7-3]
ENST00000581276; ENSP00000464690; ENSG00000153982 [Q8N9F7-2]
GeneIDi284161
KEGGihsa:284161
UCSCiuc002ixj.4 human [Q8N9F7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
284161

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GDPD1
HGNCiHGNC:20883 GDPD1
MIMi616317 gene
neXtProtiNX_Q8N9F7
OpenTargetsiENSG00000153982
PharmGKBiPA134879258

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2258 Eukaryota
COG0584 LUCA
GeneTreeiENSGT00940000156673
HOGENOMiHOG000008170
InParanoidiQ8N9F7
KOiK22387
OMAiVHVWTID
OrthoDBi1143305at2759
PhylomeDBiQ8N9F7
TreeFamiTF328545

Enzyme and pathway databases

BRENDAi3.1.4.46 2681
ReactomeiR-HSA-6814848 Glycerophospholipid catabolism

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GDPD1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
284161
PharosiQ8N9F7

Protein Ontology

More...
PROi
PR:Q8N9F7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000153982 Expressed in 162 organ(s), highest expression level in primary visual cortex
ExpressionAtlasiQ8N9F7 baseline and differential
GenevisibleiQ8N9F7 HS

Family and domain databases

Gene3Di3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR030395 GP_PDE_dom
IPR017946 PLC-like_Pdiesterase_TIM-brl
PfamiView protein in Pfam
PF03009 GDPD, 1 hit
SUPFAMiSSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS51704 GP_PDE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGDPD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N9F7
Secondary accession number(s): A8W735, Q56VR1, Q8N4E3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: October 16, 2019
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again