Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (02 Jun 2021)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Cytochrome c oxidase assembly protein COX18, mitochondrial

Gene

COX18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mitochondrial membrane insertase required for the translocation of the C-terminus of cytochrome c oxidase subunit II (MT-CO2/COX2) across the mitochondrial inner membrane. Plays a role in MT-CO2/COX2 maturation following the COX20-mediated stabilization of newly synthesized MT-CO2/COX2 protein and before the action of the metallochaperones SCO1/2. Essential for the assembly and stability of the mitochondrial respiratory chain complex IV (also known as cytochrome c oxidase).

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • membrane insertase activity Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N8Q8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5628897, TP53 Regulates Metabolic Genes
R-HSA-611105, Respiratory electron transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.9.1.3, the membrane protein insertase (yidc/alb3/oxa1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome c oxidase assembly protein COX18, mitochondrial
Short name:
COX18Hs
Alternative name(s):
Cytochrome c oxidase assembly protein 18
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COX18
Synonyms:OXA1L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26801, COX18

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610428, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N8Q8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000163626.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini? – 167Mitochondrial intermembrane1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Topological domaini189 – 223Mitochondrial matrix1 PublicationAdd BLAST35
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21
Topological domaini245 – 262Mitochondrial intermembrane1 PublicationAdd BLAST18
Transmembranei263 – 283HelicalSequence analysisAdd BLAST21
Topological domaini284 – 333Mitochondrial matrix1 PublicationAdd BLAST50

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
285521

Open Targets

More...
OpenTargetsi
ENSG00000163626

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145008543

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N8Q8, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COX18

Domain mapping of disease mutations (DMDM)

More...
DMDMi
38372495

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – ?MitochondrionSequence analysis
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000020354? – 333Cytochrome c oxidase assembly protein COX18, mitochondrial

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N8Q8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N8Q8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N8Q8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N8Q8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N8Q8

PeptideAtlas

More...
PeptideAtlasi
Q8N8Q8

PRoteomics IDEntifications database

More...
PRIDEi
Q8N8Q8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72449 [Q8N8Q8-1]
72450 [Q8N8Q8-2]
72451 [Q8N8Q8-3]
72452 [Q8N8Q8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N8Q8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N8Q8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163626, Expressed in female gonad and 218 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N8Q8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N8Q8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000163626, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with TMEM177, COA6, MT-CO2/COX2, COX20, SCO1 and SCO2 (PubMed:29154948).

Interacts transiently with MT-CO2/COX2 during its maturation (PubMed:28330871).

Interacts with COX20 in a MT-CO2/COX2-dependent manner (PubMed:28330871).

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
130132, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N8Q8, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000425261

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N8Q8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the OXA1/ALB3/YidC family.Curated

Keywords - Domaini

Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1239, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063506

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2003161_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N8Q8

Database of Orthologous Groups

More...
OrthoDBi
1314061at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N8Q8

TreeFam database of animal gene trees

More...
TreeFami
TF323948

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001708, YidC/ALB3/OXA1/COX18

The PANTHER Classification System

More...
PANTHERi
PTHR12428, PTHR12428, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02096, 60KD_IMP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N8Q8-1) [UniParc]FASTAAdd to basket
Also known as: Hs1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLCRLGGRWL RPLPALQLWA RDLPLAPVPT SGAKRPTLPV WAVAPVSAVH
60 70 80 90 100
ANGWYEALAA SSPVRVAEEV LLGVHAATGL PWWGSILLST VALRGAVTLP
110 120 130 140 150
LAAYQHYILA KVENLQPEIK TIARHLNQEV AVRANQLGWS KRDARLTYLK
160 170 180 190 200
NMRRLISELY VRDNCHPFKA TVLVWIQLPM WIFMSFALRN LSTGAAHSEG
210 220 230 240 250
FSVQEQLATG GILWFPDLTA PDSTWILPIS VGVINLLIVE ICALQKIGMS
260 270 280 290 300
RFQTYITYFV RAMSVLMIPI AATVPSSIVL YWLCSSFVGL SQNLLLRSPG
310 320 330
FRQLCRIPST KSDSETPYKD IFAAFNTKFI SRK
Length:333
Mass (Da):37,063
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4F2C18C7E78C08EE
GO
Isoform 2 (identifier: Q8N8Q8-2) [UniParc]FASTAAdd to basket
Also known as: Hs2

The sequence of this isoform differs from the canonical sequence as follows:
     112-127: VENLQPEIKTIARHLN → LGGKFAARNKNYCQAS
     128-333: Missing.

Show »
Length:127
Mass (Da):13,573
Checksum:i61DFF76DFF75C2AD
GO
Isoform 3 (identifier: Q8N8Q8-3) [UniParc]FASTAAdd to basket
Also known as: Hs3

The sequence of this isoform differs from the canonical sequence as follows:
     112-129: VENLQPEIKTIARHLNQE → AHLSKEYEEANFRAICAR
     130-333: Missing.

Show »
Length:129
Mass (Da):13,953
Checksum:i46E17277116D3A94
GO
Isoform 4 (identifier: Q8N8Q8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-147: ENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLT → VSMGKKNRKQNRNGISSNIKAVSHFTGRMSTGQEQ
     148-333: Missing.

Show »
Length:147
Mass (Da):15,822
Checksum:i87C295B3F8F4F91E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZL88B7ZL88_HUMAN
COX18 protein
COX18
334Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH71812 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti311K → R in CAJ20055 (PubMed:16911509).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022311112 – 129VENLQ…HLNQE → AHLSKEYEEANFRAICAR in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_022312112 – 127VENLQ…ARHLN → LGGKFAARNKNYCQAS in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_022313113 – 147ENLQP…DARLT → VSMGKKNRKQNRNGISSNIK AVSHFTGRMSTGQEQ in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_022314128 – 333Missing in isoform 2. 1 PublicationAdd BLAST206
Alternative sequenceiVSP_022315130 – 333Missing in isoform 3. 1 PublicationAdd BLAST204
Alternative sequenceiVSP_022316148 – 333Missing in isoform 4. 1 PublicationAdd BLAST186

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY957564 mRNA Translation: AAY35060.1
AY957565 mRNA Translation: AAY35061.1
AK096310 mRNA Translation: BAC04758.1
BC071812 mRNA Translation: AAH71812.1 Sequence problems.
BC101684 mRNA Translation: AAI01685.1
AM055750 mRNA Translation: CAJ20055.1
AM055751 mRNA Translation: CAJ20056.1
AM055752 mRNA Translation: CAJ20057.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3554.1 [Q8N8Q8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001284662.1, NM_001297733.1
NP_001287658.1, NM_001300729.1
NP_776188.1, NM_173827.3 [Q8N8Q8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000295890; ENSP00000295890; ENSG00000163626 [Q8N8Q8-1]
ENST00000449739; ENSP00000394583; ENSG00000163626 [Q8N8Q8-3]
ENST00000510031; ENSP00000424978; ENSG00000163626 [Q8N8Q8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
285521

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:285521

UCSC genome browser

More...
UCSCi
uc003hgm.2, human [Q8N8Q8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY957564 mRNA Translation: AAY35060.1
AY957565 mRNA Translation: AAY35061.1
AK096310 mRNA Translation: BAC04758.1
BC071812 mRNA Translation: AAH71812.1 Sequence problems.
BC101684 mRNA Translation: AAI01685.1
AM055750 mRNA Translation: CAJ20055.1
AM055751 mRNA Translation: CAJ20056.1
AM055752 mRNA Translation: CAJ20057.1
CCDSiCCDS3554.1 [Q8N8Q8-1]
RefSeqiNP_001284662.1, NM_001297733.1
NP_001287658.1, NM_001300729.1
NP_776188.1, NM_173827.3 [Q8N8Q8-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi130132, 4 interactors
IntActiQ8N8Q8, 1 interactor
STRINGi9606.ENSP00000425261

Protein family/group databases

TCDBi2.A.9.1.3, the membrane protein insertase (yidc/alb3/oxa1) family

PTM databases

iPTMnetiQ8N8Q8
PhosphoSitePlusiQ8N8Q8

Genetic variation databases

BioMutaiCOX18
DMDMi38372495

Proteomic databases

EPDiQ8N8Q8
jPOSTiQ8N8Q8
MassIVEiQ8N8Q8
MaxQBiQ8N8Q8
PaxDbiQ8N8Q8
PeptideAtlasiQ8N8Q8
PRIDEiQ8N8Q8
ProteomicsDBi72449 [Q8N8Q8-1]
72450 [Q8N8Q8-2]
72451 [Q8N8Q8-3]
72452 [Q8N8Q8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
44370, 83 antibodies

The DNASU plasmid repository

More...
DNASUi
285521

Genome annotation databases

EnsembliENST00000295890; ENSP00000295890; ENSG00000163626 [Q8N8Q8-1]
ENST00000449739; ENSP00000394583; ENSG00000163626 [Q8N8Q8-3]
ENST00000510031; ENSP00000424978; ENSG00000163626 [Q8N8Q8-2]
GeneIDi285521
KEGGihsa:285521
UCSCiuc003hgm.2, human [Q8N8Q8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285521
DisGeNETi285521

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COX18
HGNCiHGNC:26801, COX18
HPAiENSG00000163626, Low tissue specificity
MIMi610428, gene
neXtProtiNX_Q8N8Q8
OpenTargetsiENSG00000163626
PharmGKBiPA145008543
VEuPathDBiHostDB:ENSG00000163626.16

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1239, Eukaryota
GeneTreeiENSGT00530000063506
HOGENOMiCLU_2003161_0_0_1
InParanoidiQ8N8Q8
OrthoDBi1314061at2759
PhylomeDBiQ8N8Q8
TreeFamiTF323948

Enzyme and pathway databases

PathwayCommonsiQ8N8Q8
ReactomeiR-HSA-5628897, TP53 Regulates Metabolic Genes
R-HSA-611105, Respiratory electron transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
285521, 104 hits in 995 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COX18, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
285521
PharosiQ8N8Q8, Tbio

Protein Ontology

More...
PROi
PR:Q8N8Q8
RNActiQ8N8Q8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163626, Expressed in female gonad and 218 other tissues
ExpressionAtlasiQ8N8Q8, baseline and differential
GenevisibleiQ8N8Q8, HS

Family and domain databases

InterProiView protein in InterPro
IPR001708, YidC/ALB3/OXA1/COX18
PANTHERiPTHR12428, PTHR12428, 1 hit
PfamiView protein in Pfam
PF02096, 60KD_IMP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOX18_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N8Q8
Secondary accession number(s): Q2PB66
, Q2PB67, Q2PB68, Q49B97, Q6IPP9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: October 1, 2002
Last modified: June 2, 2021
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again