Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q8N8Q1 (C56D1_HUMAN)

Entry version 137 (29 Sep 2021)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Probable transmembrane reductase CYB561D1

Gene

CYB561D1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transmembrane reductase that may use ascorbate as an electron donor and transfer electrons across membranes to reduce monodehydro-L-ascorbate radical and iron cations Fe3+ in another cellular compartment.

Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

heme bBy similarityNote: Binds 2 heme b groups non-covalently.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi55Iron 1 (heme b 1 axial ligand); via tele nitrogenBy similarity1
Metal bindingi93Iron 2 (heme b 2 axial ligand); via tele nitrogenBy similarity1
Metal bindingi127Iron 1 (heme b 1 axial ligand); via tele nitrogenBy similarity1
Metal bindingi166Iron 2 (heme b 2 axial ligand); via tele nitrogenBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTranslocase
Biological processElectron transport, Transport
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8N8Q1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable transmembrane reductase CYB561D1Curated (EC:7.2.1.3Curated)
Alternative name(s):
Cytochrome b561 domain-containing protein 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYB561D1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26804, CYB561D1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N8Q1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000174151

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 24CytoplasmicCuratedAdd BLAST24
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45HelicalSequence analysisAdd BLAST21
Topological domaini46 – 53LumenalCurated8
Transmembranei54 – 74HelicalSequence analysisAdd BLAST21
Topological domaini75 – 91CytoplasmicCuratedAdd BLAST17
Transmembranei92 – 112HelicalSequence analysisAdd BLAST21
Topological domaini113 – 128LumenalCuratedAdd BLAST16
Transmembranei129 – 149HelicalSequence analysisAdd BLAST21
Topological domaini150 – 169CytoplasmicCuratedAdd BLAST20
Transmembranei170 – 190HelicalSequence analysisAdd BLAST21
Topological domaini191 – 193LumenalCurated3
Transmembranei194 – 214HelicalSequence analysisAdd BLAST21
Topological domaini215 – 229CytoplasmicCuratedAdd BLAST15

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		284613

Open Targets

More...OpenTargetsi		ENSG00000174151

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134872038

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8N8Q1, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CYB561D1

Domain mapping of disease mutations (DMDM)

More...DMDMi		67462193

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001510341 – 229Probable transmembrane reductase CYB561D1Add BLAST229

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N8Q1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8N8Q1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N8Q1

PeptideAtlas

More...PeptideAtlasi		Q8N8Q1

PRoteomics IDEntifications database

More...PRIDEi		Q8N8Q1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19474
64575
72442 [Q8N8Q1-1]
72443 [Q8N8Q1-2]
72444 [Q8N8Q1-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q8N8Q1-1 [Q8N8Q1-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N8Q1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N8Q1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000174151, Expressed in upper arm skin and 168 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8N8Q1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N8Q1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000174151, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		129916, 3 interactors

Protein interaction database and analysis system

More...IntActi		Q8N8Q1, 3 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8N8Q1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 224Cytochrome b561PROSITE-ProRule annotationAdd BLAST203

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00440000038072

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_072399_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N8Q1

Identification of Orthologs from Complete Genome Data

More...OMAi		GSPFCFK

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N8Q1

TreeFam database of animal gene trees

More...TreeFami		TF323584

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006593, Cyt_b561/ferric_Rdtase_TM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03188, Cytochrom_B561, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00665, B561, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50939, CYTOCHROME_B561, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N8Q1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQPLEVGLVP APAGEPRLTR WLRRGSGILA HLVALGFTIF LTALSRPGTS 
        60         70         80         90        100
LFSWHPVFMA LAFCLCMAEA ILLFSPEHSL FFFCSRKARI RLHWAGQTLA 
       110        120        130        140        150
ILCAALGLGF IISSRTRSEL PHLVSWHSWV GALTLLATAV QALCGLCLLC 
       160        170        180        190        200
PRAARVSRVA RLKLYHLTCG LVVYLMATVT VLLGMYSVWF QAQIKGAAWY 
       210        220 
LCLALPVYPA LVIMHQISRS YLPRKKMEM
Length:229
Mass (Da):25,424
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i43978DAF7D8EC218
GO
Isoform 2 (identifier: Q8N8Q1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP
     134-229: Missing.

Show »
Length:133
Mass (Da):14,251
Checksum:i60B7E9CE48574852
GO
Isoform 3 (identifier: Q8N8Q1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE

Show »
Length:251
Mass (Da):27,731
Checksum:i9F8B854A243A1492
GO
Isoform 4 (identifier: Q8N8Q1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-229: SLFSWHPVFM...SYLPRKKMEM → KTGPLMEDRS...PMFTVLPLHG

Show »
Length:128
Mass (Da):14,197
Checksum:iBE94AF3C98A3AB6A
GO
Isoform 5 (identifier: Q8N8Q1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-62: Missing.

Show »
Length:172
Mass (Da):19,314
Checksum:i2665E7E094E494F1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQU0E9PQU0_HUMAN
Probable transmembrane reductase CY...
CYB561D1
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIJ2E9PIJ2_HUMAN
Probable transmembrane reductase CY...
CYB561D1
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PM70E9PM70_HUMAN
Probable transmembrane reductase CY...
CYB561D1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIK3E9PIK3_HUMAN
Probable transmembrane reductase CY...
CYB561D1
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0469856 – 62Missing in isoform 5. CuratedAdd BLAST57
Alternative sequenceiVSP_04698650 – 229SLFSW…KKMEM → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRMYESTSFFSGLQ ARHEAYWLSPMFTVLPLHG in isoform 4. CuratedAdd BLAST180
Alternative sequenceiVSP_03864950 – 133SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_04116250 – 62SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_038650134 – 229Missing in isoform 2. 1 PublicationAdd BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK096354 mRNA Translation: BAC04767.1
AK294992 mRNA Translation: BAG58058.1
DA092655 mRNA No translation available.
AL355145 Genomic DNA No translation available.
BC093683 mRNA Translation: AAH93683.1
BC111999 mRNA Translation: AAI12000.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44188.1 [Q8N8Q1-3]
CCDS44189.1 [Q8N8Q1-5]
CCDS44190.1 [Q8N8Q1-2]
CCDS44191.1 [Q8N8Q1-4]
CCDS800.1 [Q8N8Q1-1]

NCBI Reference Sequences

More...RefSeqi		NP_001127872.1, NM_001134400.1 [Q8N8Q1-3]
NP_001127874.1, NM_001134402.1 [Q8N8Q1-5]
NP_872386.1, NM_182580.2 [Q8N8Q1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000310611; ENSP00000309324; ENSG00000174151 [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151 [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151 [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151 [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151 [Q8N8Q1-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		284613

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:284613

UCSC genome browser

More...UCSCi		uc001dxu.4, human [Q8N8Q1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096354 mRNA Translation: BAC04767.1
AK294992 mRNA Translation: BAG58058.1
DA092655 mRNA No translation available.
AL355145 Genomic DNA No translation available.
BC093683 mRNA Translation: AAH93683.1
BC111999 mRNA Translation: AAI12000.1
CCDSiCCDS44188.1 [Q8N8Q1-3]
CCDS44189.1 [Q8N8Q1-5]
CCDS44190.1 [Q8N8Q1-2]
CCDS44191.1 [Q8N8Q1-4]
CCDS800.1 [Q8N8Q1-1]
RefSeqiNP_001127872.1, NM_001134400.1 [Q8N8Q1-3]
NP_001127874.1, NM_001134402.1 [Q8N8Q1-5]
NP_872386.1, NM_182580.2 [Q8N8Q1-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi129916, 3 interactors
IntActiQ8N8Q1, 3 interactors

PTM databases

iPTMnetiQ8N8Q1
PhosphoSitePlusiQ8N8Q1

Genetic variation databases

BioMutaiCYB561D1
DMDMi67462193

Proteomic databases

jPOSTiQ8N8Q1
MassIVEiQ8N8Q1
MaxQBiQ8N8Q1
PeptideAtlasiQ8N8Q1
PRIDEiQ8N8Q1
ProteomicsDBi19474
64575
72442 [Q8N8Q1-1]
72443 [Q8N8Q1-2]
72444 [Q8N8Q1-3]
TopDownProteomicsiQ8N8Q1-1 [Q8N8Q1-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		20066, 113 antibodies

The DNASU plasmid repository

More...DNASUi		284613

Genome annotation databases

EnsembliENST00000310611; ENSP00000309324; ENSG00000174151 [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151 [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151 [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151 [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151 [Q8N8Q1-4]
GeneIDi284613
KEGGihsa:284613
UCSCiuc001dxu.4, human [Q8N8Q1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		284613
DisGeNETi284613

GeneCards: human genes, protein and diseases

More...GeneCardsi		CYB561D1
HGNCiHGNC:26804, CYB561D1
HPAiENSG00000174151, Low tissue specificity
neXtProtiNX_Q8N8Q1
OpenTargetsiENSG00000174151
PharmGKBiPA134872038
VEuPathDBiHostDB:ENSG00000174151

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00440000038072
HOGENOMiCLU_072399_3_1_1
InParanoidiQ8N8Q1
OMAiGSPFCFK
PhylomeDBiQ8N8Q1
TreeFamiTF323584

Enzyme and pathway databases

PathwayCommonsiQ8N8Q1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		284613, 12 hits in 1016 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CYB561D1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		284613
PharosiQ8N8Q1, Tdark

Protein Ontology

More...PROi		PR:Q8N8Q1
RNActiQ8N8Q1, protein

Gene expression databases

BgeeiENSG00000174151, Expressed in upper arm skin and 168 other tissues
ExpressionAtlasiQ8N8Q1, baseline and differential
GenevisibleiQ8N8Q1, HS

Family and domain databases

InterProiView protein in InterPro
IPR006593, Cyt_b561/ferric_Rdtase_TM
PfamiView protein in Pfam
PF03188, Cytochrom_B561, 1 hit
SMARTiView protein in SMART
SM00665, B561, 1 hit
PROSITEiView protein in PROSITE
PS50939, CYTOCHROME_B561, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC56D1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N8Q1
Secondary accession number(s): B4DH97
, E9PCM8, Q52M36, Q5T6C2, Q5T6C3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: October 1, 2002
Last modified: September 29, 2021
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again