Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (22 Apr 2020)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription elongation factor A N-terminal and central domain-containing protein

Gene

TCEANC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription elongation factor A N-terminal and central domain-containing protein
Alternative name(s):
TFIIS central domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TCEANC
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28277 TCEANC

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N8B7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000176896

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N8B7 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TCEANC

Domain mapping of disease mutations (DMDM)

More...
DMDMi
117949797

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002596591 – 351Transcription elongation factor A N-terminal and central domain-containing proteinAdd BLAST351

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N8B7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N8B7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N8B7

PeptideAtlas

More...
PeptideAtlasi
Q8N8B7

PRoteomics IDEntifications database

More...
PRIDEi
Q8N8B7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72395 [Q8N8B7-1]
72396 [Q8N8B7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N8B7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N8B7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000176896 Expressed in leukocyte and 118 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N8B7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N8B7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000176896 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Isoform 2 [Q8N8B7-2]
With#Exp.IntAct
ADARB1 - isoform 4 [P78563-4]3EBI-11955057,EBI-12002366
AKAP9 [Q6PJH3]3EBI-11955057,EBI-11745576
ANAPC11 - isoform 2 [Q9NYG5-2]3EBI-11955057,EBI-12224467
AXIN2 [Q9Y2T1]3EBI-11955057,EBI-4400025
BICD2 - isoform 2 [Q8TD16-2]3EBI-11955057,EBI-11975051
C1QTNF2 [Q9BXJ5]3EBI-11955057,EBI-2817707
CARD9 - isoform 2 [Q9H257-2]3EBI-11955057,EBI-11530605
CCDC102B [Q68D86]3EBI-11955057,EBI-10171570
CCDC138 - isoform 2 [Q96M89-2]3EBI-11955057,EBI-10972887
CCNC [P24863]3EBI-11955057,EBI-395261
CDR2L [Q86X02]3EBI-11955057,EBI-11063830
CEP70 [Q8NHQ1]3EBI-11955057,EBI-739624
CEP76 [Q8TAP6]3EBI-11955057,EBI-742887
CRACR2B - isoform 3 [Q8N4Y2-3]3EBI-11955057,EBI-11982645
CREB3L3 [Q68CJ9]3EBI-11955057,EBI-852194
CSRNP1 [Q96S65]3EBI-11955057,EBI-4311573
CTAG1B [P78358]3EBI-11955057,EBI-1188472
CYSRT1 [A8MQ03]3EBI-11955057,EBI-3867333
DISC1 - isoform 2 [Q9NRI5-2]3EBI-11955057,EBI-11988027
DMAP1 [Q9NPF5]3EBI-11955057,EBI-399105
DTX3 [Q8N9I9]3EBI-11955057,EBI-2340258
DVL3 [Q92997]3EBI-11955057,EBI-739789
DYNLT1 [P63172]3EBI-11955057,EBI-1176455
EVI5 [O60447]3EBI-11955057,EBI-852291
FAM217B [Q9NTX9]3EBI-11955057,EBI-19153639
FANCG [O15287]3EBI-11955057,EBI-81610
FCHO1 [A0A0C3SFZ9]3EBI-11955057,EBI-11977403
GOLGA2 [Q08379]3EBI-11955057,EBI-618309
GOLGA6L9 [A6NEM1]3EBI-11955057,EBI-5916454
HES7 [Q9BYE0]3EBI-11955057,EBI-12163087
HIP1 [O00291]3EBI-11955057,EBI-473886
HOOK2 - isoform 2 [Q96ED9-2]3EBI-11955057,EBI-10961706
IGF1 - isoform 2 [P05019-2]3EBI-11955057,EBI-12837046
IKZF2 - isoform 2 [Q9UKS7-2]3EBI-11955057,EBI-11536241
IKZF3 [Q9UKT9]3EBI-11955057,EBI-747204
KATNBL1 [Q9H079]3EBI-11955057,EBI-715394
KCTD6 [Q8NC69]3EBI-11955057,EBI-2511344
KCTD7 - isoform 2 [Q96MP8-2]3EBI-11955057,EBI-11954971
KIAA1958 [Q8N8K9]3EBI-11955057,EBI-10181113
KIF16B - isoform 5 [Q96L93-6]3EBI-11955057,EBI-10988217
KLHL12 [Q53G59]3EBI-11955057,EBI-740929
KRT31 [Q15323]3EBI-11955057,EBI-948001
KRT35 [Q92764]3EBI-11955057,EBI-1058674
KRT40 [Q6A162]3EBI-11955057,EBI-10171697
KRTAP1-1 [Q07627]3EBI-11955057,EBI-11959885
KRTAP10-8 [P60410]3EBI-11955057,EBI-10171774
KRTAP12-3 [P60328]3EBI-11955057,EBI-11953334
KRTAP5-9 [P26371]3EBI-11955057,EBI-3958099
L3MBTL3 - isoform 2 [Q96JM7-2]3EBI-11955057,EBI-11985629
LDOC1 [O95751]3EBI-11955057,EBI-740738
LHX2 [P50458]3EBI-11955057,EBI-12179869
LHX3 - isoform B [Q9UBR4-2]3EBI-11955057,EBI-12039345
LIN7B [Q9HAP6]3EBI-11955057,EBI-821335
LSM14B - isoform 2 [Q9BX40-2]3EBI-11955057,EBI-19133880
MCC [P23508]3EBI-11955057,EBI-307531
MCIDAS [D6RGH6]3EBI-11955057,EBI-3954372
MDFI [Q99750]3EBI-11955057,EBI-724076
MEOX2 [Q6FHY5]3EBI-11955057,EBI-16439278
MID2 - isoform 2 [Q9UJV3-2]3EBI-11955057,EBI-10172526
MTUS2 - isoform 2 [Q5JR59-3]3EBI-11955057,EBI-11522433
MYF5 [P13349]3EBI-11955057,EBI-17491620
MYLIP [Q8WY64]3EBI-11955057,EBI-6952711
NAB2 [Q15742]3EBI-11955057,EBI-8641936
NECAB1 [Q8N987]3EBI-11955057,EBI-11956853
OOEP [A6NGQ2]3EBI-11955057,EBI-18583589
OSBPL3 [Q9H4L5]3EBI-11955057,EBI-1051317
PICK1 [Q9NRD5]3EBI-11955057,EBI-79165
PLEKHF2 [Q9H8W4]3EBI-11955057,EBI-742388
PNMA1 [Q8ND90]3EBI-11955057,EBI-302345
PNMA5 [Q96PV4]3EBI-11955057,EBI-10171633
PXN - isoform Alpha [P49023-2]3EBI-11955057,EBI-11954250
RNF41 [Q9H4P4]3EBI-11955057,EBI-2130266
RUBCN [Q92622]3EBI-11955057,EBI-2952709
SIPA1L2 - isoform 2 [Q9P2F8-2]3EBI-11955057,EBI-10326741
SORBS3 [O60504]3EBI-11955057,EBI-741237
SPERT - isoform 2 [Q8NA61-2]3EBI-11955057,EBI-11524851
SSNA1 [O43805]3EBI-11955057,EBI-2515299
STRN3 - isoform Alpha [Q13033-2]3EBI-11955057,EBI-1053876
STX1A [Q16623]3EBI-11955057,EBI-712466
STX4 [Q12846]3EBI-11955057,EBI-744942
TARBP2 [Q15633]3EBI-11955057,EBI-978581
TCP10L [Q8TDR4]3EBI-11955057,EBI-3923210
THAP1 [Q9NVV9]3EBI-11955057,EBI-741515
TLE5 - isoform 2 [Q08117-2]3EBI-11955057,EBI-11741437
TMCO2 [Q7Z6W1]3EBI-11955057,EBI-12807858
TNIP1 [Q15025]3EBI-11955057,EBI-357849
TNIP3 [Q96KP6]3EBI-11955057,EBI-2509913
TRAF2 [Q12933]3EBI-11955057,EBI-355744
TRIM23 [P36406]3EBI-11955057,EBI-740098
TRIM27 [P14373]5EBI-11955057,EBI-719493
TRIM32 [Q13049]3EBI-11955057,EBI-742790
TRIM35 - isoform 2 [Q9UPQ4-2]3EBI-11955057,EBI-17716262
TRIM37 [O94972]3EBI-11955057,EBI-741602
TRIM41 [Q8WV44]5EBI-11955057,EBI-725997
TRIM54 [Q9BYV2]3EBI-11955057,EBI-2130429
UBXN11 - isoform 6 [Q5T124-6]3EBI-11955057,EBI-11524408
USH1G [Q495M9]3EBI-11955057,EBI-8601749
USHBP1 [Q8N6Y0]3EBI-11955057,EBI-739895
VAC14 [Q08AM6]3EBI-11955057,EBI-2107455
VBP1 [P61758]3EBI-11955057,EBI-357430
VPS52 [Q8N1B4]3EBI-11955057,EBI-2799833
ZBTB14 [O43829]3EBI-11955057,EBI-10176632
ZBTB39 [O15060]3EBI-11955057,EBI-9995672
ZBTB9 [Q96C00]3EBI-11955057,EBI-395708
ZFYVE26 - isoform 5 [Q68DK2-5]3EBI-11955057,EBI-8656416
ZKSCAN7 - isoform 2 [Q9P0L1-2]3EBI-11955057,EBI-10698225
ZNF276 [Q8N554]3EBI-11955057,EBI-750821
ZNF655 [Q8N720]3EBI-11955057,EBI-625509
ZNF670 [Q9BS34]3EBI-11955057,EBI-745276
ZNF688 [P0C7X2]3EBI-11955057,EBI-4395732
ZNF837 [Q96EG3]3EBI-11955057,EBI-11962574
ZRANB1 [Q9UGI0]3EBI-11955057,EBI-527853
Q8N8B7
With#Exp.IntAct
CARD9 [Q9H257]3EBI-954696,EBI-751319
CRACR2B [Q8N4Y2]3EBI-954696,EBI-10267893
CSRNP1 [Q96S65]3EBI-954696,EBI-4311573
DAB1 [O75553]3EBI-954696,EBI-7875264
FAM9B [Q8IZU0]3EBI-954696,EBI-10175124
FSBP [O95073]3EBI-954696,EBI-1059030
FSD2 [A1L4K1]3EBI-954696,EBI-5661036
GOLGA2 [Q08379]3EBI-954696,EBI-618309
HMBOX1 [Q6NT76]3EBI-954696,EBI-2549423
KIFC3 [Q9BVG8]3EBI-954696,EBI-2125614
KRTAP10-7 [P60409]3EBI-954696,EBI-10172290
KRTAP4-2 [Q9BYR5]3EBI-954696,EBI-10172511
KRTAP5-9 [P26371]3EBI-954696,EBI-3958099
MEOX1 [P50221]3EBI-954696,EBI-2864512
MID1 [O15344]3EBI-954696,EBI-2340316
NAB2 [Q15742]3EBI-954696,EBI-8641936
OBI1 [Q5W0B1]3EBI-954696,EBI-2562035
PNMA1 [Q8ND90]3EBI-954696,EBI-302345
SPERT [Q8NA61]3EBI-954696,EBI-741724
SSNA1 [O43805]3EBI-954696,EBI-2515299
TARBP2 [Q15633]3EBI-954696,EBI-978581
VAC14 [Q08AM6]3EBI-954696,EBI-2107455
VPS52 [Q8N1B4]3EBI-954696,EBI-2799833
ZBTB14 [O43829]3EBI-954696,EBI-10176632

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127996, 40 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N8B7, 126 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440038

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N8B7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 82TFIIS N-terminalPROSITE-ProRule annotationAdd BLAST78
Domaini173 – 289TFIIS centralPROSITE-ProRule annotationAdd BLAST117

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1105 Eukaryota
COG1594 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162067

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_890113_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N8B7

Identification of Orthologs from Complete Genome Data

More...
OMAi
VPENRAI

Database of Orthologous Groups

More...
OrthoDBi
1579101at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N8B7

TreeFam database of animal gene trees

More...
TreeFami
TF314970

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.472.30, 1 hit
1.20.930.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035100 TF_IIS-typ
IPR035441 TFIIS/LEDGF_dom_sf
IPR003618 TFIIS_cen_dom
IPR036575 TFIIS_cen_dom_sf
IPR017923 TFIIS_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08711 Med26, 1 hit
PF07500 TFIIS_M, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF006704 TF_IIS, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00510 TFS2M, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46942 SSF46942, 1 hit
SSF47676 SSF47676, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51321 TFIIS_CENTRAL, 1 hit
PS51319 TFIIS_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N8B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDKNQIAAR ASLIEQLMSK RNFEDLGNHL TELETIYVTK EHLQETDVVR
60 70 80 90 100
AVYRVLKNCP SVALKKKAKC LLSKWKAVYK QTHSKARNSP KLFPVRGNKE
110 120 130 140 150
ENSGPSHDPS QNETLGICSS NSLSSQDVAK LSEMIVPENR AIQLKPKEEH
160 170 180 190 200
FGDGDPESTG KRSSELLDPT TPMRTKCIEL LYAALTSSST DQPKADLWQN
210 220 230 240 250
FAREIEEHVF TLYSKNIKKY KTCIRSKVAN LKNPRNSHLQ QNLLSGTTSP
260 270 280 290 300
REFAEMTVME MANKELKQLR ASYTESCIQE HYLPQVIDGT QTNKIKCRRC
310 320 330 340 350
EKYNCKVTVI DRGTLFLPSW VRNSNPDEQM MTYVICNECG EQWYHSKWVC

W
Length:351
Mass (Da):40,245
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC48E135BCDC27B9E
GO
Isoform 2 (identifier: Q8N8B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MISAHRKLCLPGSSNSPASAFRVAGTTAVKM

Show »
Length:381
Mass (Da):43,285
Checksum:i49D59A9DD90A66D3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YF26H0YF26_HUMAN
Transcription elongation factor A N...
TCEANC
272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC04930 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_028970163S → L1 PublicationCorresponds to variant dbSNP:rs2361159Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0398951M → MISAHRKLCLPGSSNSPASA FRVAGTTAVKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK097032 mRNA Translation: BAC04930.1 Different initiation.
AK315599 mRNA Translation: BAG37970.1
DC344354 mRNA No translation available.
AC079383 Genomic DNA No translation available.
BC020095 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48081.1 [Q8N8B7-2]
CCDS75954.1 [Q8N8B7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001284492.1, NM_001297563.1 [Q8N8B7-1]
NP_001284493.1, NM_001297564.1 [Q8N8B7-1]
XP_016884805.1, XM_017029316.1 [Q8N8B7-2]
XP_016884806.1, XM_017029317.1 [Q8N8B7-1]
XP_016884807.1, XM_017029318.1 [Q8N8B7-1]
XP_016884808.1, XM_017029319.1 [Q8N8B7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380600; ENSP00000369974; ENSG00000176896 [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896 [Q8N8B7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
170082

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:170082

UCSC genome browser

More...
UCSCi
uc064yao.1 human [Q8N8B7-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA Translation: BAC04930.1 Different initiation.
AK315599 mRNA Translation: BAG37970.1
DC344354 mRNA No translation available.
AC079383 Genomic DNA No translation available.
BC020095 mRNA No translation available.
CCDSiCCDS48081.1 [Q8N8B7-2]
CCDS75954.1 [Q8N8B7-1]
RefSeqiNP_001284492.1, NM_001297563.1 [Q8N8B7-1]
NP_001284493.1, NM_001297564.1 [Q8N8B7-1]
XP_016884805.1, XM_017029316.1 [Q8N8B7-2]
XP_016884806.1, XM_017029317.1 [Q8N8B7-1]
XP_016884807.1, XM_017029318.1 [Q8N8B7-1]
XP_016884808.1, XM_017029319.1 [Q8N8B7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi127996, 40 interactors
IntActiQ8N8B7, 126 interactors
STRINGi9606.ENSP00000440038

PTM databases

iPTMnetiQ8N8B7
PhosphoSitePlusiQ8N8B7

Polymorphism and mutation databases

BioMutaiTCEANC
DMDMi117949797

Proteomic databases

EPDiQ8N8B7
MassIVEiQ8N8B7
PaxDbiQ8N8B7
PeptideAtlasiQ8N8B7
PRIDEiQ8N8B7
ProteomicsDBi72395 [Q8N8B7-1]
72396 [Q8N8B7-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
400 14 antibodies

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896 [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896 [Q8N8B7-2]
GeneIDi170082
KEGGihsa:170082
UCSCiuc064yao.1 human [Q8N8B7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
170082

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TCEANC
HGNCiHGNC:28277 TCEANC
HPAiENSG00000176896 Low tissue specificity
neXtProtiNX_Q8N8B7
OpenTargetsiENSG00000176896

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1105 Eukaryota
COG1594 LUCA
GeneTreeiENSGT00940000162067
HOGENOMiCLU_890113_0_0_1
InParanoidiQ8N8B7
OMAiVPENRAI
OrthoDBi1579101at2759
PhylomeDBiQ8N8B7
TreeFamiTF314970

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
170082
PharosiQ8N8B7 Tdark

Protein Ontology

More...
PROi
PR:Q8N8B7
RNActiQ8N8B7 protein

Gene expression databases

BgeeiENSG00000176896 Expressed in leukocyte and 118 other tissues
ExpressionAtlasiQ8N8B7 baseline and differential
GenevisibleiQ8N8B7 HS

Family and domain databases

Gene3Di1.10.472.30, 1 hit
1.20.930.10, 1 hit
InterProiView protein in InterPro
IPR035100 TF_IIS-typ
IPR035441 TFIIS/LEDGF_dom_sf
IPR003618 TFIIS_cen_dom
IPR036575 TFIIS_cen_dom_sf
IPR017923 TFIIS_N
PfamiView protein in Pfam
PF08711 Med26, 1 hit
PF07500 TFIIS_M, 1 hit
PIRSFiPIRSF006704 TF_IIS, 1 hit
SMARTiView protein in SMART
SM00510 TFS2M, 1 hit
SUPFAMiSSF46942 SSF46942, 1 hit
SSF47676 SSF47676, 1 hit
PROSITEiView protein in PROSITE
PS51321 TFIIS_CENTRAL, 1 hit
PS51319 TFIIS_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEANC_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N8B7
Secondary accession number(s): A6NI06, B2RDM3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: April 22, 2020
This is version 147 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again