Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription elongation factor A N-terminal and central domain-containing protein

Gene

TCEANC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription elongation factor A N-terminal and central domain-containing protein
Alternative name(s):
TFIIS central domain-containing protein 1
Gene namesi
Name:TCEANC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000176896.8
HGNCiHGNC:28277 TCEANC
neXtProtiNX_Q8N8B7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000176896

Polymorphism and mutation databases

BioMutaiTCEANC
DMDMi117949797

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002596591 – 351Transcription elongation factor A N-terminal and central domain-containing proteinAdd BLAST351

Proteomic databases

EPDiQ8N8B7
PaxDbiQ8N8B7
PeptideAtlasiQ8N8B7
PRIDEiQ8N8B7
ProteomicsDBi72395
72396 [Q8N8B7-2]

PTM databases

iPTMnetiQ8N8B7
PhosphoSitePlusiQ8N8B7

Expressioni

Gene expression databases

BgeeiENSG00000176896 Expressed in 119 organ(s), highest expression level in leukocyte
ExpressionAtlasiQ8N8B7 baseline and differential
GenevisibleiQ8N8B7 HS

Organism-specific databases

HPAiHPA001013

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi127996, 39 interactors
IntActiQ8N8B7, 125 interactors
STRINGi9606.ENSP00000313886

Structurei

3D structure databases

ProteinModelPortaliQ8N8B7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 82TFIIS N-terminalPROSITE-ProRule annotationAdd BLAST78
Domaini173 – 289TFIIS centralPROSITE-ProRule annotationAdd BLAST117

Phylogenomic databases

eggNOGiKOG1105 Eukaryota
COG1594 LUCA
GeneTreeiENSGT00390000017794
HOGENOMiHOG000234470
InParanoidiQ8N8B7
OMAiLKNCPSV
OrthoDBiEOG091G08RS
PhylomeDBiQ8N8B7
TreeFamiTF314970

Family and domain databases

Gene3Di1.10.472.30, 1 hit
1.20.930.10, 1 hit
InterProiView protein in InterPro
IPR035100 TF_IIS-typ
IPR035441 TFIIS/LEDGF_dom_sf
IPR003618 TFIIS_cen_dom
IPR036575 TFIIS_cen_dom_sf
IPR017923 TFIIS_N
PfamiView protein in Pfam
PF08711 Med26, 1 hit
PF07500 TFIIS_M, 1 hit
PIRSFiPIRSF006704 TF_IIS, 1 hit
SMARTiView protein in SMART
SM00510 TFS2M, 1 hit
SUPFAMiSSF46942 SSF46942, 1 hit
SSF47676 SSF47676, 1 hit
PROSITEiView protein in PROSITE
PS51321 TFIIS_CENTRAL, 1 hit
PS51319 TFIIS_N, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N8B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDKNQIAAR ASLIEQLMSK RNFEDLGNHL TELETIYVTK EHLQETDVVR
60 70 80 90 100
AVYRVLKNCP SVALKKKAKC LLSKWKAVYK QTHSKARNSP KLFPVRGNKE
110 120 130 140 150
ENSGPSHDPS QNETLGICSS NSLSSQDVAK LSEMIVPENR AIQLKPKEEH
160 170 180 190 200
FGDGDPESTG KRSSELLDPT TPMRTKCIEL LYAALTSSST DQPKADLWQN
210 220 230 240 250
FAREIEEHVF TLYSKNIKKY KTCIRSKVAN LKNPRNSHLQ QNLLSGTTSP
260 270 280 290 300
REFAEMTVME MANKELKQLR ASYTESCIQE HYLPQVIDGT QTNKIKCRRC
310 320 330 340 350
EKYNCKVTVI DRGTLFLPSW VRNSNPDEQM MTYVICNECG EQWYHSKWVC

W
Length:351
Mass (Da):40,245
Last modified:October 31, 2006 - v2
Checksum:iC48E135BCDC27B9E
GO
Isoform 2 (identifier: Q8N8B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MISAHRKLCLPGSSNSPASAFRVAGTTAVKM

Show »
Length:381
Mass (Da):43,285
Checksum:i49D59A9DD90A66D3
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YF26H0YF26_HUMAN
Transcription elongation factor A N...
TCEANC
272Annotation score:

Sequence cautioni

The sequence BAC04930 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028970163S → L1 PublicationCorresponds to variant dbSNP:rs2361159Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0398951M → MISAHRKLCLPGSSNSPASA FRVAGTTAVKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA Translation: BAC04930.1 Different initiation.
AK315599 mRNA Translation: BAG37970.1
DC344354 mRNA No translation available.
AC079383 Genomic DNA No translation available.
BC020095 mRNA No translation available.
CCDSiCCDS48081.1 [Q8N8B7-2]
CCDS75954.1 [Q8N8B7-1]
RefSeqiNP_001284492.1, NM_001297563.1 [Q8N8B7-1]
NP_001284493.1, NM_001297564.1 [Q8N8B7-1]
XP_016884805.1, XM_017029316.1 [Q8N8B7-2]
XP_016884806.1, XM_017029317.1 [Q8N8B7-1]
XP_016884807.1, XM_017029318.1 [Q8N8B7-1]
XP_016884808.1, XM_017029319.1 [Q8N8B7-1]
UniGeneiHs.222855
Hs.737398

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896 [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896 [Q8N8B7-2]
GeneIDi170082
KEGGihsa:170082
UCSCiuc064yao.1 human [Q8N8B7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA Translation: BAC04930.1 Different initiation.
AK315599 mRNA Translation: BAG37970.1
DC344354 mRNA No translation available.
AC079383 Genomic DNA No translation available.
BC020095 mRNA No translation available.
CCDSiCCDS48081.1 [Q8N8B7-2]
CCDS75954.1 [Q8N8B7-1]
RefSeqiNP_001284492.1, NM_001297563.1 [Q8N8B7-1]
NP_001284493.1, NM_001297564.1 [Q8N8B7-1]
XP_016884805.1, XM_017029316.1 [Q8N8B7-2]
XP_016884806.1, XM_017029317.1 [Q8N8B7-1]
XP_016884807.1, XM_017029318.1 [Q8N8B7-1]
XP_016884808.1, XM_017029319.1 [Q8N8B7-1]
UniGeneiHs.222855
Hs.737398

3D structure databases

ProteinModelPortaliQ8N8B7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127996, 39 interactors
IntActiQ8N8B7, 125 interactors
STRINGi9606.ENSP00000313886

PTM databases

iPTMnetiQ8N8B7
PhosphoSitePlusiQ8N8B7

Polymorphism and mutation databases

BioMutaiTCEANC
DMDMi117949797

Proteomic databases

EPDiQ8N8B7
PaxDbiQ8N8B7
PeptideAtlasiQ8N8B7
PRIDEiQ8N8B7
ProteomicsDBi72395
72396 [Q8N8B7-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896 [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896 [Q8N8B7-2]
GeneIDi170082
KEGGihsa:170082
UCSCiuc064yao.1 human [Q8N8B7-1]

Organism-specific databases

CTDi170082
EuPathDBiHostDB:ENSG00000176896.8
GeneCardsiTCEANC
HGNCiHGNC:28277 TCEANC
HPAiHPA001013
neXtProtiNX_Q8N8B7
OpenTargetsiENSG00000176896
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1105 Eukaryota
COG1594 LUCA
GeneTreeiENSGT00390000017794
HOGENOMiHOG000234470
InParanoidiQ8N8B7
OMAiLKNCPSV
OrthoDBiEOG091G08RS
PhylomeDBiQ8N8B7
TreeFamiTF314970

Miscellaneous databases

ChiTaRSiTCEANC human
GenomeRNAii170082
PROiPR:Q8N8B7

Gene expression databases

BgeeiENSG00000176896 Expressed in 119 organ(s), highest expression level in leukocyte
ExpressionAtlasiQ8N8B7 baseline and differential
GenevisibleiQ8N8B7 HS

Family and domain databases

Gene3Di1.10.472.30, 1 hit
1.20.930.10, 1 hit
InterProiView protein in InterPro
IPR035100 TF_IIS-typ
IPR035441 TFIIS/LEDGF_dom_sf
IPR003618 TFIIS_cen_dom
IPR036575 TFIIS_cen_dom_sf
IPR017923 TFIIS_N
PfamiView protein in Pfam
PF08711 Med26, 1 hit
PF07500 TFIIS_M, 1 hit
PIRSFiPIRSF006704 TF_IIS, 1 hit
SMARTiView protein in SMART
SM00510 TFS2M, 1 hit
SUPFAMiSSF46942 SSF46942, 1 hit
SSF47676 SSF47676, 1 hit
PROSITEiView protein in PROSITE
PS51321 TFIIS_CENTRAL, 1 hit
PS51319 TFIIS_N, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTEANC_HUMAN
AccessioniPrimary (citable) accession number: Q8N8B7
Secondary accession number(s): A6NI06, B2RDM3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: September 12, 2018
This is version 136 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again