Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8N7R7 (CCYL1_HUMAN)

Entry version 154 (02 Jun 2021)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Cyclin-Y-like protein 1

Gene

CCNYL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCyclin

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8N7R7

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8N7R7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-Y-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCNYL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:26868, CCNYL1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N7R7

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000163249.9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		151195

Open Targets

More...OpenTargetsi		ENSG00000163249

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162382009

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8N7R7, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCNYL1

Domain mapping of disease mutations (DMDM)

More...DMDMi		160380580

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003093211 – 359Cyclin-Y-like protein 1Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei67PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei112PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8N7R7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N7R7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8N7R7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N7R7

PeptideAtlas

More...PeptideAtlasi		Q8N7R7

PRoteomics IDEntifications database

More...PRIDEi		Q8N7R7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		72321 [Q8N7R7-1]
72322 [Q8N7R7-2]
72323 [Q8N7R7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N7R7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N7R7

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8N7R7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163249, Expressed in secondary oocyte and 211 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8N7R7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N7R7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000163249, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		127353, 45 interactors

Protein interaction database and analysis system

More...IntActi		Q8N7R7, 35 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8N7R7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini145 – 267Cyclin N-terminalAdd BLAST123

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclin family. Cyclin Y subfamily.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154453

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_055026_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N7R7

Identification of Orthologs from Complete Genome Data

More...OMAi		LRTTIKX

Database of Orthologous Groups

More...OrthoDBi		916284at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N7R7

TreeFam database of animal gene trees

More...TreeFami		TF314464

Family and domain databases

Conserved Domains Database

More...CDDi		cd00043, CYCLIN, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013763, Cyclin-like
IPR036915, Cyclin-like_sf
IPR006671, Cyclin_N
IPR012399, Cyclin_Y

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00134, Cyclin_N, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF028934, Cyclin_CG14939, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00385, CYCLIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47954, SSF47954, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N7R7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNTLTCCVS PNASPKLGRR AGSAELYCAS DIYEAVSGDA VAVAPAVVEP 
        60         70         80         90        100
AELDFGEGEG HHLQHISDRE MPEDLALESN PSDHPRASTI FLSKSQTDVR 
       110        120        130        140        150
EKRKSNHLNH VSPGQLTKKY SSCSTIFLDD STVSQPNLRT TVKCVTLAIY 
       160        170        180        190        200
YHIKNRDANR SLDIFDERSH PLTREKVPEE YFKHDPEHKF IYRFVRTLFS 
       210        220        230        240        250
AAQLTAECAI VTLVYLERLL TYAEIDICPT NWKRIVLGAI LLASKVWDDQ 
       260        270        280        290        300
AVWNVDYCQI LKDITVEDMN EMERHFLELL QFNINVPASV YAKYYFDLRS 
       310        320        330        340        350
LADDNNLNFL FAPLSKERAQ NLEAISRLCE DKDLCRAAMR RSFSADNFIG 

IQRSKAILS
Length:359
Mass (Da):40,705
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i76381F33FE5C890C
GO
Isoform 2 (identifier: Q8N7R7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: VSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLT → CDLSNILPHKEQ

Show »
Length:308
Mass (Da):34,956
Checksum:i2A39C7F18F74AA02
GO
Isoform 3 (identifier: Q8N7R7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:289
Mass (Da):33,452
Checksum:iE994C632BFE75CDC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A494C0K2A0A494C0K2_HUMAN
Cyclin-Y-like protein 1
CCNYL1
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0P7H7C0P7_HUMAN
Cyclin-Y-like protein 1
CCNYL1
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYB8C9IYB8_HUMAN
Cyclin-Y-like protein 1
CCNYL1
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZD2H7BZD2_HUMAN
Cyclin-Y-like protein 1
CCNYL1
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH67253 differs from that shown. Reason: Frameshift.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0291331 – 70Missing in isoform 3. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_029134111 – 173VSPGQ…SHPLT → CDLSNILPHKEQ in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK097751 mRNA Translation: BAC05160.1
AC096772 Genomic DNA Translation: AAY24056.1
CH471063 Genomic DNA Translation: EAW70420.1
BC067253 mRNA Translation: AAH67253.1 Frameshift.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2377.1 [Q8N7R7-3]
CCDS46503.1 [Q8N7R7-2]
CCDS82564.1 [Q8N7R7-1]

NCBI Reference Sequences

More...RefSeqi		NP_001135772.1, NM_001142300.1 [Q8N7R7-2]
NP_001317147.1, NM_001330218.1 [Q8N7R7-1]
NP_689736.1, NM_152523.2 [Q8N7R7-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000295414; ENSP00000295414; ENSG00000163249 [Q8N7R7-1]
ENST00000339882; ENSP00000342344; ENSG00000163249 [Q8N7R7-2]
ENST00000392209; ENSP00000376045; ENSG00000163249 [Q8N7R7-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		151195

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:151195

UCSC genome browser

More...UCSCi		uc002vch.4, human [Q8N7R7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097751 mRNA Translation: BAC05160.1
AC096772 Genomic DNA Translation: AAY24056.1
CH471063 Genomic DNA Translation: EAW70420.1
BC067253 mRNA Translation: AAH67253.1 Frameshift.
CCDSiCCDS2377.1 [Q8N7R7-3]
CCDS46503.1 [Q8N7R7-2]
CCDS82564.1 [Q8N7R7-1]
RefSeqiNP_001135772.1, NM_001142300.1 [Q8N7R7-2]
NP_001317147.1, NM_001330218.1 [Q8N7R7-1]
NP_689736.1, NM_152523.2 [Q8N7R7-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi127353, 45 interactors
IntActiQ8N7R7, 35 interactors

PTM databases

iPTMnetiQ8N7R7
PhosphoSitePlusiQ8N7R7
SwissPalmiQ8N7R7

Genetic variation databases

BioMutaiCCNYL1
DMDMi160380580

Proteomic databases

EPDiQ8N7R7
jPOSTiQ8N7R7
MassIVEiQ8N7R7
MaxQBiQ8N7R7
PeptideAtlasiQ8N7R7
PRIDEiQ8N7R7
ProteomicsDBi72321 [Q8N7R7-1]
72322 [Q8N7R7-2]
72323 [Q8N7R7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		52166, 116 antibodies

The DNASU plasmid repository

More...DNASUi		151195

Genome annotation databases

EnsembliENST00000295414; ENSP00000295414; ENSG00000163249 [Q8N7R7-1]
ENST00000339882; ENSP00000342344; ENSG00000163249 [Q8N7R7-2]
ENST00000392209; ENSP00000376045; ENSG00000163249 [Q8N7R7-3]
GeneIDi151195
KEGGihsa:151195
UCSCiuc002vch.4, human [Q8N7R7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		151195
DisGeNETi151195

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCNYL1
HGNCiHGNC:26868, CCNYL1
HPAiENSG00000163249, Low tissue specificity
neXtProtiNX_Q8N7R7
OpenTargetsiENSG00000163249
PharmGKBiPA162382009
VEuPathDBiHostDB:ENSG00000163249.9

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000154453
HOGENOMiCLU_055026_0_0_1
InParanoidiQ8N7R7
OMAiLRTTIKX
OrthoDBi916284at2759
PhylomeDBiQ8N7R7
TreeFamiTF314464

Enzyme and pathway databases

PathwayCommonsiQ8N7R7
SignaLinkiQ8N7R7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		151195, 65 hits in 997 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCNYL1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		151195
PharosiQ8N7R7, Tdark

Protein Ontology

More...PROi		PR:Q8N7R7
RNActiQ8N7R7, protein

Gene expression databases

BgeeiENSG00000163249, Expressed in secondary oocyte and 211 other tissues
ExpressionAtlasiQ8N7R7, baseline and differential
GenevisibleiQ8N7R7, HS

Family and domain databases

CDDicd00043, CYCLIN, 1 hit
InterProiView protein in InterPro
IPR013763, Cyclin-like
IPR036915, Cyclin-like_sf
IPR006671, Cyclin_N
IPR012399, Cyclin_Y
PfamiView protein in Pfam
PF00134, Cyclin_N, 1 hit
PIRSFiPIRSF028934, Cyclin_CG14939, 1 hit
SMARTiView protein in SMART
SM00385, CYCLIN, 1 hit
SUPFAMiSSF47954, SSF47954, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCYL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N7R7
Secondary accession number(s): Q6NX60
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: June 2, 2021
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again