Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (12 Aug 2020)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable E3 ubiquitin-protein ligase TRIML2

Gene

TRIML2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N7C3

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase TRIML2 (EC:2.3.2.27)
Alternative name(s):
RING-type E3 ubiquitin transferase TRIML2Curated
SPRY domain-containing protein 6
Tripartite motif family-like protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRIML2
Synonyms:SPRYD6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000179046.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26378, TRIML2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N7C3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
205860

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407031

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N7C3, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRIML2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74714998

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003174351 – 387Probable E3 ubiquitin-protein ligase TRIML2Add BLAST387

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N7C3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N7C3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N7C3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N7C3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N7C3

PeptideAtlas

More...
PeptideAtlasi
Q8N7C3

PRoteomics IDEntifications database

More...
PRIDEi
Q8N7C3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6780
72286 [Q8N7C3-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N7C3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N7C3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000179046, Expressed in placenta and 81 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N7C3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N7C3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000179046, Group enriched (placenta, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Q8N7C3
With#Exp.IntAct
ABI2 - isoform 2 [Q9NYB9-2]3EBI-11059915,EBI-11096309
BLOC1S2 [Q6QNY1]4EBI-11059915,EBI-465872
CBY2 - isoform 2 [Q8NA61-2]3EBI-11059915,EBI-11524851
CCDC146 [Q8IYE0]3EBI-11059915,EBI-10749669
CCDC92 [Q53HC0]6EBI-11059915,EBI-719994
CCHCR1 - isoform 3 [Q8TD31-3]3EBI-11059915,EBI-10175300
CCNH [P51946]3EBI-11059915,EBI-741406
CDR2 [Q01850]3EBI-11059915,EBI-1181367
CTBP2 - isoform 3 [P56545-3]3EBI-11059915,EBI-10171902
EIF2B1 [Q14232]3EBI-11059915,EBI-491065
EIF3M [Q7L2H7]3EBI-11059915,EBI-353901
FAM90A1 [Q86YD7]3EBI-11059915,EBI-6658203
FAM9C [Q8IZT9]3EBI-11059915,EBI-2870039
HGS [O14964]3EBI-11059915,EBI-740220
ING5 [Q8WYH8]3EBI-11059915,EBI-488533
ITGB3BP [Q13352]3EBI-11059915,EBI-712105
KRT15 [P19012]3EBI-11059915,EBI-739566
KRT24 [Q2M2I5]3EBI-11059915,EBI-2952736
KRT27 [Q7Z3Y8]3EBI-11059915,EBI-3044087
KRT31 [Q15323]3EBI-11059915,EBI-948001
KRT34 [O76011]3EBI-11059915,EBI-1047093
KRT38 [O76015]3EBI-11059915,EBI-1047263
KRT75 [O95678]3EBI-11059915,EBI-2949715
MBD3L2 [Q8NHZ7]3EBI-11059915,EBI-11989378
MBD3L3 [A6NE82]3EBI-11059915,EBI-17422057
MEOX1 [P50221]3EBI-11059915,EBI-2864512
MEOX2 [Q6FHY5]3EBI-11059915,EBI-16439278
NECAB2 - isoform 2 [Q7Z6G3-2]4EBI-11059915,EBI-10172876
NFKBID [Q8NI38]3EBI-11059915,EBI-10271199
NUP62 [P37198]3EBI-11059915,EBI-347978
PICK1 [Q9NRD5]3EBI-11059915,EBI-79165
POU6F2 [P78424]3EBI-11059915,EBI-12029004
SH2D4A [Q9H788]3EBI-11059915,EBI-747035
STN1 [Q9H668]3EBI-11059915,EBI-746930
SYCE2 [Q6PIF2]5EBI-11059915,EBI-11958386
TBC1D25 [Q3MII6]3EBI-11059915,EBI-11899977
TCF4 - isoform SEF2-1D [P15884-3]3EBI-11059915,EBI-13636688
TFIP11 [Q9UBB9]3EBI-11059915,EBI-1105213
TRIM54 [Q9BYV2]3EBI-11059915,EBI-2130429
itself3EBI-11059915,EBI-11059915
TSEN54 [Q7Z6J9]3EBI-11059915,EBI-2559824
TSG101 [Q99816]3EBI-11059915,EBI-346882
USHBP1 [Q8N6Y0]3EBI-11059915,EBI-739895
XAF1 [Q6GPH4]3EBI-11059915,EBI-2815120
ZBED1 [O96006]3EBI-11059915,EBI-740037
ZBTB33 [Q86T24]5EBI-11059915,EBI-2515625
ZFHX3 - isoform B [Q15911-2]3EBI-11059915,EBI-10237226
ZNRD1 [Q9P1U0]3EBI-11059915,EBI-355434

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
128500, 17 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N7C3, 57 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000422581

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N7C3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N7C3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini181 – 379B30.2/SPRYPROSITE-ProRule annotationAdd BLAST199

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili5 – 150Sequence analysisAdd BLAST146

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2177, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N7C3

KEGG Orthology (KO)

More...
KOi
K12039

Database of Orthologous Groups

More...
OrthoDBi
423686at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N7C3

TreeFam database of animal gene trees

More...
TreeFami
TF338674

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.920, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR003879, Butyrophylin_SPRY
IPR013320, ConA-like_dom_sf
IPR006574, PRY
IPR003877, SPRY_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13765, PRY, 1 hit
PF00622, SPRY, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01407, BUTYPHLNCDUF

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00589, PRY, 1 hit
SM00449, SPRY, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899, SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50188, B302_SPRY, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N7C3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVCGIQEAAE NYRKLFQEIL NTSREKLEAA KSILTDEQER MAMIQEEEQN
60 70 80 90 100
FKKMIESEYS MRLRLLNEEC EQNLQRQQEC ISDLNLRETL LNQAIKLATE
110 120 130 140 150
LEEMFQEMLQ RLGRVGRENM EKLKESEARA SEQVRSLLKL IVELEKKCGE
160 170 180 190 200
GTLALLKNAK YSLERSKSLL LEHLEPAHIT DLSLCHIRGL SSMFRVLQRH
210 220 230 240 250
LTLDPETAHP CLALSEDLRT MRLRHGQQDG AGNPERLDFS AMVLAAESFT
260 270 280 290 300
SGRHYWEVDV EKATRWQVGI YHGSADAKGS TARASGEKVL LTGSVMGTEW
310 320 330 340 350
TLWVFPPLKR LFLEKKLDTV GVFLDCEHGQ ISFYNVTEMS LIYNFSHCAF
360 370 380
QGALRPVFSL CIPNGDTSPD SLTILQHGPS CDATVSP
Length:387
Mass (Da):43,983
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57F0DA0B87F93032
GO
Isoform 2 (identifier: Q8N7C3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKRLSPQLQHNITEDAYCETHLEPTRLFCDVDQITLCSKCFQSQEHKHHM
     158-171: NAKYSLERSKSLLL → VRCWEKENKIHSSI
     172-387: Missing.

Show »
Length:221
Mass (Da):26,050
Checksum:iA5CF937B378CE162
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6T5J5Q6T5J5_HUMAN
Probable E3 ubiquitin-protein ligas...
TRIML2 FLJ25801
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KNI5J3KNI5_HUMAN
Probable E3 ubiquitin-protein ligas...
TRIML2
422Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0554461M → MSKRLSPQLQHNITEDAYCE THLEPTRLFCDVDQITLCSK CFQSQEHKHHM in isoform 2. 1 Publication1
Alternative sequenceiVSP_055447158 – 171NAKYS…KSLLL → VRCWEKENKIHSSI in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_055448172 – 387Missing in isoform 2. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK098667 mRNA Translation: BAC05372.1
AK300428 mRNA Translation: BAH13282.1
AC108073 Genomic DNA No translation available.
BC111959 mRNA Translation: AAI11960.1
BC111961 mRNA Translation: AAI11962.1

NCBI Reference Sequences

More...
RefSeqi
NP_001290348.1, NM_001303419.1
NP_775824.2, NM_173553.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000512729; ENSP00000422581; ENSG00000179046

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
205860

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:205860

UCSC genome browser

More...
UCSCi
uc003izl.3, human [Q8N7C3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098667 mRNA Translation: BAC05372.1
AK300428 mRNA Translation: BAH13282.1
AC108073 Genomic DNA No translation available.
BC111959 mRNA Translation: AAI11960.1
BC111961 mRNA Translation: AAI11962.1
RefSeqiNP_001290348.1, NM_001303419.1
NP_775824.2, NM_173553.2

3D structure databases

SMRiQ8N7C3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi128500, 17 interactors
IntActiQ8N7C3, 57 interactors
STRINGi9606.ENSP00000422581

PTM databases

iPTMnetiQ8N7C3
PhosphoSitePlusiQ8N7C3

Polymorphism and mutation databases

BioMutaiTRIML2
DMDMi74714998

Proteomic databases

EPDiQ8N7C3
jPOSTiQ8N7C3
MassIVEiQ8N7C3
MaxQBiQ8N7C3
PaxDbiQ8N7C3
PeptideAtlasiQ8N7C3
PRIDEiQ8N7C3
ProteomicsDBi6780
72286 [Q8N7C3-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
49227, 53 antibodies

Genome annotation databases

EnsembliENST00000512729; ENSP00000422581; ENSG00000179046
GeneIDi205860
KEGGihsa:205860
UCSCiuc003izl.3, human [Q8N7C3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
205860
DisGeNETi205860
EuPathDBiHostDB:ENSG00000179046.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRIML2
HGNCiHGNC:26378, TRIML2
HPAiENSG00000179046, Group enriched (placenta, testis)
neXtProtiNX_Q8N7C3
PharmGKBiPA162407031

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2177, Eukaryota
InParanoidiQ8N7C3
KOiK12039
OrthoDBi423686at2759
PhylomeDBiQ8N7C3
TreeFamiTF338674

Enzyme and pathway databases

UniPathwayiUPA00143
PathwayCommonsiQ8N7C3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
205860, 2 hits in 865 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
205860
PharosiQ8N7C3, Tdark

Protein Ontology

More...
PROi
PR:Q8N7C3
RNActiQ8N7C3, protein

Gene expression databases

BgeeiENSG00000179046, Expressed in placenta and 81 other tissues
ExpressionAtlasiQ8N7C3, baseline and differential
GenevisibleiQ8N7C3, HS

Family and domain databases

Gene3Di2.60.120.920, 1 hit
InterProiView protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR003879, Butyrophylin_SPRY
IPR013320, ConA-like_dom_sf
IPR006574, PRY
IPR003877, SPRY_dom
PfamiView protein in Pfam
PF13765, PRY, 1 hit
PF00622, SPRY, 1 hit
PRINTSiPR01407, BUTYPHLNCDUF
SMARTiView protein in SMART
SM00589, PRY, 1 hit
SM00449, SPRY, 1 hit
SUPFAMiSSF49899, SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188, B302_SPRY, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRIMM_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N7C3
Secondary accession number(s): B7Z6J6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 1, 2002
Last modified: August 12, 2020
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again