Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase TRIML2

Gene

TRIML2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase TRIML2 (EC:2.3.2.27)
Alternative name(s):
RING-type E3 ubiquitin transferase TRIML2Curated
SPRY domain-containing protein 6
Tripartite motif family-like protein 2
Gene namesi
Name:TRIML2
Synonyms:SPRYD6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000179046.8
HGNCiHGNC:26378 TRIML2
neXtProtiNX_Q8N7C3

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162407031

Polymorphism and mutation databases

BioMutaiTRIML2
DMDMi74714998

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003174351 – 387Probable E3 ubiquitin-protein ligase TRIML2Add BLAST387

Proteomic databases

EPDiQ8N7C3
MaxQBiQ8N7C3
PaxDbiQ8N7C3
PeptideAtlasiQ8N7C3
PRIDEiQ8N7C3
ProteomicsDBi72286

PTM databases

iPTMnetiQ8N7C3
PhosphoSitePlusiQ8N7C3

Expressioni

Gene expression databases

BgeeiENSG00000179046 Expressed in 53 organ(s), highest expression level in placenta
CleanExiHS_TRIML2
ExpressionAtlasiQ8N7C3 baseline and differential
GenevisibleiQ8N7C3 HS

Organism-specific databases

HPAiHPA043838

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ZBTB33Q86T243EBI-11059915,EBI-2515625

Protein-protein interaction databases

BioGridi128500, 15 interactors
IntActiQ8N7C3, 47 interactors
STRINGi9606.ENSP00000422581

Structurei

3D structure databases

ProteinModelPortaliQ8N7C3
SMRiQ8N7C3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini181 – 379B30.2/SPRYPROSITE-ProRule annotationAdd BLAST199

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili5 – 150Sequence analysisAdd BLAST146

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG41112S7 LUCA
HOVERGENiHBG106592
InParanoidiQ8N7C3
KOiK12039
PhylomeDBiQ8N7C3
TreeFamiTF338674

Family and domain databases

InterProiView protein in InterPro
IPR001870 B30.2/SPRY
IPR003879 Butyrophylin_SPRY
IPR013320 ConA-like_dom_sf
IPR006574 PRY
IPR003877 SPRY_dom
PfamiView protein in Pfam
PF13765 PRY, 1 hit
PF00622 SPRY, 1 hit
PRINTSiPR01407 BUTYPHLNCDUF
SMARTiView protein in SMART
SM00589 PRY, 1 hit
SM00449 SPRY, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188 B302_SPRY, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N7C3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVCGIQEAAE NYRKLFQEIL NTSREKLEAA KSILTDEQER MAMIQEEEQN
60 70 80 90 100
FKKMIESEYS MRLRLLNEEC EQNLQRQQEC ISDLNLRETL LNQAIKLATE
110 120 130 140 150
LEEMFQEMLQ RLGRVGRENM EKLKESEARA SEQVRSLLKL IVELEKKCGE
160 170 180 190 200
GTLALLKNAK YSLERSKSLL LEHLEPAHIT DLSLCHIRGL SSMFRVLQRH
210 220 230 240 250
LTLDPETAHP CLALSEDLRT MRLRHGQQDG AGNPERLDFS AMVLAAESFT
260 270 280 290 300
SGRHYWEVDV EKATRWQVGI YHGSADAKGS TARASGEKVL LTGSVMGTEW
310 320 330 340 350
TLWVFPPLKR LFLEKKLDTV GVFLDCEHGQ ISFYNVTEMS LIYNFSHCAF
360 370 380
QGALRPVFSL CIPNGDTSPD SLTILQHGPS CDATVSP
Length:387
Mass (Da):43,983
Last modified:October 1, 2002 - v1
Checksum:i57F0DA0B87F93032
GO
Isoform 2 (identifier: Q8N7C3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKRLSPQLQHNITEDAYCETHLEPTRLFCDVDQITLCSKCFQSQEHKHHM
     158-171: NAKYSLERSKSLLL → VRCWEKENKIHSSI
     172-387: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):26,050
Checksum:iA5CF937B378CE162
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6T5J5Q6T5J5_HUMAN
Probable E3 ubiquitin-protein ligas...
TRIML2 FLJ25801
118Annotation score:
J3KNI5J3KNI5_HUMAN
Probable E3 ubiquitin-protein ligas...
TRIML2
422Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0554461M → MSKRLSPQLQHNITEDAYCE THLEPTRLFCDVDQITLCSK CFQSQEHKHHM in isoform 2. 1 Publication1
Alternative sequenceiVSP_055447158 – 171NAKYS…KSLLL → VRCWEKENKIHSSI in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_055448172 – 387Missing in isoform 2. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098667 mRNA Translation: BAC05372.1
AK300428 mRNA Translation: BAH13282.1
AC108073 Genomic DNA No translation available.
BC111959 mRNA Translation: AAI11960.1
BC111961 mRNA Translation: AAI11962.1
RefSeqiNP_001290348.1, NM_001303419.1
NP_775824.2, NM_173553.2
UniGeneiHs.276429

Genome annotation databases

EnsembliENST00000512729; ENSP00000422581; ENSG00000179046
GeneIDi205860
KEGGihsa:205860
UCSCiuc003izl.3 human [Q8N7C3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098667 mRNA Translation: BAC05372.1
AK300428 mRNA Translation: BAH13282.1
AC108073 Genomic DNA No translation available.
BC111959 mRNA Translation: AAI11960.1
BC111961 mRNA Translation: AAI11962.1
RefSeqiNP_001290348.1, NM_001303419.1
NP_775824.2, NM_173553.2
UniGeneiHs.276429

3D structure databases

ProteinModelPortaliQ8N7C3
SMRiQ8N7C3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128500, 15 interactors
IntActiQ8N7C3, 47 interactors
STRINGi9606.ENSP00000422581

PTM databases

iPTMnetiQ8N7C3
PhosphoSitePlusiQ8N7C3

Polymorphism and mutation databases

BioMutaiTRIML2
DMDMi74714998

Proteomic databases

EPDiQ8N7C3
MaxQBiQ8N7C3
PaxDbiQ8N7C3
PeptideAtlasiQ8N7C3
PRIDEiQ8N7C3
ProteomicsDBi72286

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000512729; ENSP00000422581; ENSG00000179046
GeneIDi205860
KEGGihsa:205860
UCSCiuc003izl.3 human [Q8N7C3-1]

Organism-specific databases

CTDi205860
EuPathDBiHostDB:ENSG00000179046.8
GeneCardsiTRIML2
HGNCiHGNC:26378 TRIML2
HPAiHPA043838
neXtProtiNX_Q8N7C3
PharmGKBiPA162407031
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG41112S7 LUCA
HOVERGENiHBG106592
InParanoidiQ8N7C3
KOiK12039
PhylomeDBiQ8N7C3
TreeFamiTF338674

Enzyme and pathway databases

UniPathwayi
UPA00143

Miscellaneous databases

GenomeRNAii205860
PROiPR:Q8N7C3

Gene expression databases

BgeeiENSG00000179046 Expressed in 53 organ(s), highest expression level in placenta
CleanExiHS_TRIML2
ExpressionAtlasiQ8N7C3 baseline and differential
GenevisibleiQ8N7C3 HS

Family and domain databases

InterProiView protein in InterPro
IPR001870 B30.2/SPRY
IPR003879 Butyrophylin_SPRY
IPR013320 ConA-like_dom_sf
IPR006574 PRY
IPR003877 SPRY_dom
PfamiView protein in Pfam
PF13765 PRY, 1 hit
PF00622 SPRY, 1 hit
PRINTSiPR01407 BUTYPHLNCDUF
SMARTiView protein in SMART
SM00589 PRY, 1 hit
SM00449 SPRY, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188 B302_SPRY, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTRIMM_HUMAN
AccessioniPrimary (citable) accession number: Q8N7C3
Secondary accession number(s): B7Z6J6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 1, 2002
Last modified: September 12, 2018
This is version 110 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again