Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (10 Apr 2019)
Sequence version 3 (17 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 655

Gene

ZNF655

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri212 – 234C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri303 – 325C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri330 – 353C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri380 – 402C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri408 – 430C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 655
Alternative name(s):
Vav-interacting Krueppel-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF655
Synonyms:VIK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000197343.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30899 ZNF655

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617891 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N720

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000197343

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134883537

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF655

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242863

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000477001 – 491Zinc finger protein 655Add BLAST491

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki77Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki190Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 2 (identifier: Q8N720-2)
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei60PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N720

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N720

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N720

PeptideAtlas

More...
PeptideAtlasi
Q8N720

PRoteomics IDEntifications database

More...
PRIDEi
Q8N720

ProteomicsDB human proteome resource

More...
ProteomicsDBi
72255
72256 [Q8N720-2]
72257 [Q8N720-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N720

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N720

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000197343 Expressed in 201 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N720 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N720 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029534
HPA050750

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with VAV1 and CDK4.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122495, 22 interactors

Database of interacting proteins

More...
DIPi
DIP-34108N

Protein interaction database and analysis system

More...
IntActi
Q8N720, 145 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000393876

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8N720

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri212 – 234C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri303 – 325C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri330 – 353C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri380 – 402C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri408 – 430C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00760000119441

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293236

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG018163

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N720

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECNEPEK

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N720

TreeFam database of animal gene trees

More...
TreeFami
TF344137

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 6 hits
PS50157 ZINC_FINGER_C2H2_2, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N720-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEIPAQEAA GSPRVQFQSL ETQSECLSPE PQFVQDTDME QGLTGDGETR
60 70 80 90 100
EENKLLIPKQ KISEEVHSYK VRVGRLKHDI TQVPETREVY KSEDRLERLQ
110 120 130 140 150
EILRKFLYLE REFRQITISK ETFTSEKNNE CHEPEKSFSL DSTIDADQRV
160 170 180 190 200
LRIQNTDDND KYDMSFNQNS ASGKHEHLNL TEDFQSSECK ESLMDLSHLN
210 220 230 240 250
KWESIPNTEK SYKCDVCGKI FHQSSALTRH QRIHTREKPY KCKECEKSFS
260 270 280 290 300
QSSSLSRHKR IHTREKPYKC EASDKSCEAS DKSCSPSSGI IQHKKIHTRA
310 320 330 340 350
KSYKCSSCER VFSRSVHLTQ HQKIHKEMPC KCTVCGSDFC HTSYLLEHQR
360 370 380 390 400
VHHEEKAYEY DEYGLAYIKQ QGIHFREKPY TCSECGKDFR LNSHLIQHQR
410 420 430 440 450
IHTGEKAHEC NECGKAFSQT SCLIQHHKMH RKEKSYECNE YEGSFSHSSD
460 470 480 490
LILQQEVLTR QKAFDCDVWE KNSSQRAHLV QHQSIHTKEN S
Length:491
Mass (Da):57,407
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i04FD791D769C3A80
GO
Isoform 2 (identifier: Q8N720-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL
     182-491: Missing.

Show »
Length:181
Mass (Da):20,005
Checksum:i5279EA5A29623353
GO
Isoform 3 (identifier: Q8N720-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS

Show »
Length:526
Mass (Da):61,369
Checksum:i10FD9EB53A793034
GO
Isoform 4 (identifier: Q8N720-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL
     111-491: Missing.

Note: No experimental confirmation available.
Show »
Length:110
Mass (Da):12,037
Checksum:iF59440491AE80D7B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDU5F8WDU5_HUMAN
Zinc finger protein 655
ZNF655
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WE52F8WE52_HUMAN
Zinc finger protein 655
ZNF655
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JUB9C9JUB9_HUMAN
Zinc finger protein 655
ZNF655
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYG2C9IYG2_HUMAN
Zinc finger protein 655
ZNF655
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JS03C9JS03_HUMAN
Zinc finger protein 655
ZNF655
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEB1F8WEB1_HUMAN
Zinc finger protein 655
ZNF655
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J9R2C9J9R2_HUMAN
Zinc finger protein 655
ZNF655
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCS2F8WCS2_HUMAN
Zinc finger protein 655
ZNF655
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0V9C9J0V9_HUMAN
Zinc finger protein 655
ZNF655
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNK1C9JNK1_HUMAN
Zinc finger protein 655
ZNF655
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti178L → S in BAH14395 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02816552E → D1 PublicationCorresponds to variant dbSNP:rs17853754Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04115745G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3. 1 Publication1
Alternative sequenceiVSP_03603046 – 181DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_04480946 – 110DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_044810111 – 491Missing in isoform 4. 1 PublicationAdd BLAST381
Alternative sequenceiVSP_036031182 – 491Missing in isoform 2. 1 PublicationAdd BLAST310

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY099353 mRNA Translation: AAM33786.1
AK027114 mRNA No translation available.
AK304785 mRNA Translation: BAG65536.1
AK314593 mRNA Translation: BAG37165.1
AK316024 mRNA Translation: BAH14395.1
AC005020 Genomic DNA Translation: AAS02017.1
CH236956 Genomic DNA Translation: EAL23871.1
CH471091 Genomic DNA Translation: EAW76650.1
CH236956 Genomic DNA Translation: EAL23870.1
CH471091 Genomic DNA Translation: EAW76651.1
BC000823 mRNA Translation: AAH00823.1
BC004288 mRNA Translation: AAH04288.1
BC007378 mRNA Translation: AAH07378.1
BC011816 mRNA Translation: AAH11816.1
BC024770 mRNA Translation: AAH24770.1
BC037407 mRNA Translation: AAH37407.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34695.1 [Q8N720-4]
CCDS47655.1 [Q8N720-3]
CCDS5669.1 [Q8N720-1]
CCDS5670.1 [Q8N720-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001009958.1, NM_001009958.1 [Q8N720-4]
NP_001009960.1, NM_001009960.1 [Q8N720-1]
NP_001077425.1, NM_001083956.1 [Q8N720-3]
NP_001078835.1, NM_001085366.1 [Q8N720-4]
NP_001078836.1, NM_001085367.1 [Q8N720-2]
NP_001078837.1, NM_001085368.1 [Q8N720-3]
NP_076966.1, NM_024061.3 [Q8N720-2]
NP_612503.1, NM_138494.2 [Q8N720-1]
XP_016868092.1, XM_017012603.1
XP_016868093.1, XM_017012604.1
XP_016868095.1, XM_017012606.1
XP_016868096.1, XM_017012607.1 [Q8N720-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.599798

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000252713; ENSP00000252713; ENSG00000197343 [Q8N720-1]
ENST00000320583; ENSP00000322363; ENSG00000197343 [Q8N720-2]
ENST00000357864; ENSP00000350530; ENSG00000197343 [Q8N720-4]
ENST00000394163; ENSP00000377718; ENSG00000197343 [Q8N720-1]
ENST00000424881; ENSP00000393876; ENSG00000197343 [Q8N720-3]
ENST00000440391; ENSP00000396396; ENSG00000197343 [Q8N720-4]
ENST00000493277; ENSP00000419135; ENSG00000197343 [Q8N720-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79027

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79027

UCSC genome browser

More...
UCSCi
uc003urc.4 human [Q8N720-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY099353 mRNA Translation: AAM33786.1
AK027114 mRNA No translation available.
AK304785 mRNA Translation: BAG65536.1
AK314593 mRNA Translation: BAG37165.1
AK316024 mRNA Translation: BAH14395.1
AC005020 Genomic DNA Translation: AAS02017.1
CH236956 Genomic DNA Translation: EAL23871.1
CH471091 Genomic DNA Translation: EAW76650.1
CH236956 Genomic DNA Translation: EAL23870.1
CH471091 Genomic DNA Translation: EAW76651.1
BC000823 mRNA Translation: AAH00823.1
BC004288 mRNA Translation: AAH04288.1
BC007378 mRNA Translation: AAH07378.1
BC011816 mRNA Translation: AAH11816.1
BC024770 mRNA Translation: AAH24770.1
BC037407 mRNA Translation: AAH37407.1
CCDSiCCDS34695.1 [Q8N720-4]
CCDS47655.1 [Q8N720-3]
CCDS5669.1 [Q8N720-1]
CCDS5670.1 [Q8N720-2]
RefSeqiNP_001009958.1, NM_001009958.1 [Q8N720-4]
NP_001009960.1, NM_001009960.1 [Q8N720-1]
NP_001077425.1, NM_001083956.1 [Q8N720-3]
NP_001078835.1, NM_001085366.1 [Q8N720-4]
NP_001078836.1, NM_001085367.1 [Q8N720-2]
NP_001078837.1, NM_001085368.1 [Q8N720-3]
NP_076966.1, NM_024061.3 [Q8N720-2]
NP_612503.1, NM_138494.2 [Q8N720-1]
XP_016868092.1, XM_017012603.1
XP_016868093.1, XM_017012604.1
XP_016868095.1, XM_017012606.1
XP_016868096.1, XM_017012607.1 [Q8N720-1]
UniGeneiHs.599798

3D structure databases

ProteinModelPortaliQ8N720
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122495, 22 interactors
DIPiDIP-34108N
IntActiQ8N720, 145 interactors
STRINGi9606.ENSP00000393876

PTM databases

iPTMnetiQ8N720
PhosphoSitePlusiQ8N720

Polymorphism and mutation databases

BioMutaiZNF655
DMDMi116242863

Proteomic databases

EPDiQ8N720
jPOSTiQ8N720
MaxQBiQ8N720
PeptideAtlasiQ8N720
PRIDEiQ8N720
ProteomicsDBi72255
72256 [Q8N720-2]
72257 [Q8N720-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79027
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252713; ENSP00000252713; ENSG00000197343 [Q8N720-1]
ENST00000320583; ENSP00000322363; ENSG00000197343 [Q8N720-2]
ENST00000357864; ENSP00000350530; ENSG00000197343 [Q8N720-4]
ENST00000394163; ENSP00000377718; ENSG00000197343 [Q8N720-1]
ENST00000424881; ENSP00000393876; ENSG00000197343 [Q8N720-3]
ENST00000440391; ENSP00000396396; ENSG00000197343 [Q8N720-4]
ENST00000493277; ENSP00000419135; ENSG00000197343 [Q8N720-3]
GeneIDi79027
KEGGihsa:79027
UCSCiuc003urc.4 human [Q8N720-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79027
EuPathDBiHostDB:ENSG00000197343.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF655
HGNCiHGNC:30899 ZNF655
HPAiHPA029534
HPA050750
MIMi617891 gene
neXtProtiNX_Q8N720
OpenTargetsiENSG00000197343
PharmGKBiPA134883537

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00760000119441
HOGENOMiHOG000293236
HOVERGENiHBG018163
InParanoidiQ8N720
OMAiECNEPEK
OrthoDBi1318335at2759
PhylomeDBiQ8N720
TreeFamiTF344137

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF655 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZNF655

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79027

Protein Ontology

More...
PROi
PR:Q8N720

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000197343 Expressed in 201 organ(s), highest expression level in placenta
ExpressionAtlasiQ8N720 baseline and differential
GenevisibleiQ8N720 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 5 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF57667 SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 6 hits
PS50157 ZINC_FINGER_C2H2_2, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN655_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N720
Secondary accession number(s): A4D291
, A6NGD3, B4E3M4, B7Z9Q9, D6W5T4, Q8IV00, Q8TA89, Q96EZ3, Q9BQ85
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: October 17, 2006
Last modified: April 10, 2019
This is version 149 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again