Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 655

Gene

ZNF655

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri212 – 234C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri303 – 325C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri330 – 353C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri380 – 402C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri408 – 430C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 655
Alternative name(s):
Vav-interacting Krueppel-like protein
Gene namesi
Name:ZNF655
Synonyms:VIK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000197343.10
HGNCiHGNC:30899 ZNF655
MIMi617891 gene
neXtProtiNX_Q8N720

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000197343
PharmGKBiPA134883537

Polymorphism and mutation databases

BioMutaiZNF655
DMDMi116242863

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000477001 – 491Zinc finger protein 655Add BLAST491

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki77Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki190Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 2 (identifier: Q8N720-2)
Modified residuei60PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ8N720
PeptideAtlasiQ8N720
PRIDEiQ8N720
ProteomicsDBi72255
72256 [Q8N720-2]
72257 [Q8N720-3]

PTM databases

iPTMnetiQ8N720
PhosphoSitePlusiQ8N720

Expressioni

Gene expression databases

BgeeiENSG00000197343
CleanExiHS_ZNF655
ExpressionAtlasiQ8N720 baseline and differential
GenevisibleiQ8N720 HS

Organism-specific databases

HPAiHPA029534
HPA050750

Interactioni

Subunit structurei

Interacts with VAV1 and CDK4.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122495, 21 interactors
DIPiDIP-34108N
IntActiQ8N720, 45 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8N720
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri212 – 234C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri303 – 325C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri330 – 353C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri380 – 402C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri408 – 430C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00760000119441
HOGENOMiHOG000293236
HOVERGENiHBG018163
InParanoidiQ8N720
OMAiTSCLIQH
OrthoDBiEOG091G02KC
PhylomeDBiQ8N720
TreeFamiTF344137

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF57667 SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 6 hits
PS50157 ZINC_FINGER_C2H2_2, 6 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N720-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEIPAQEAA GSPRVQFQSL ETQSECLSPE PQFVQDTDME QGLTGDGETR
60 70 80 90 100
EENKLLIPKQ KISEEVHSYK VRVGRLKHDI TQVPETREVY KSEDRLERLQ
110 120 130 140 150
EILRKFLYLE REFRQITISK ETFTSEKNNE CHEPEKSFSL DSTIDADQRV
160 170 180 190 200
LRIQNTDDND KYDMSFNQNS ASGKHEHLNL TEDFQSSECK ESLMDLSHLN
210 220 230 240 250
KWESIPNTEK SYKCDVCGKI FHQSSALTRH QRIHTREKPY KCKECEKSFS
260 270 280 290 300
QSSSLSRHKR IHTREKPYKC EASDKSCEAS DKSCSPSSGI IQHKKIHTRA
310 320 330 340 350
KSYKCSSCER VFSRSVHLTQ HQKIHKEMPC KCTVCGSDFC HTSYLLEHQR
360 370 380 390 400
VHHEEKAYEY DEYGLAYIKQ QGIHFREKPY TCSECGKDFR LNSHLIQHQR
410 420 430 440 450
IHTGEKAHEC NECGKAFSQT SCLIQHHKMH RKEKSYECNE YEGSFSHSSD
460 470 480 490
LILQQEVLTR QKAFDCDVWE KNSSQRAHLV QHQSIHTKEN S
Length:491
Mass (Da):57,407
Last modified:October 17, 2006 - v3
Checksum:i04FD791D769C3A80
GO
Isoform 2 (identifier: Q8N720-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL
     182-491: Missing.

Show »
Length:181
Mass (Da):20,005
Checksum:i5279EA5A29623353
GO
Isoform 3 (identifier: Q8N720-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS

Show »
Length:526
Mass (Da):61,369
Checksum:i10FD9EB53A793034
GO
Isoform 4 (identifier: Q8N720-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL
     111-491: Missing.

Note: No experimental confirmation available.
Show »
Length:110
Mass (Da):12,037
Checksum:iF59440491AE80D7B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti178L → S in BAH14395 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02816552E → D1 PublicationCorresponds to variant dbSNP:rs17853754Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04115745G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3. 1 Publication1
Alternative sequenceiVSP_03603046 – 181DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_04480946 – 110DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_044810111 – 491Missing in isoform 4. 1 PublicationAdd BLAST381
Alternative sequenceiVSP_036031182 – 491Missing in isoform 2. 1 PublicationAdd BLAST310

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY099353 mRNA Translation: AAM33786.1
AK027114 mRNA No translation available.
AK304785 mRNA Translation: BAG65536.1
AK314593 mRNA Translation: BAG37165.1
AK316024 mRNA Translation: BAH14395.1
AC005020 Genomic DNA Translation: AAS02017.1
CH236956 Genomic DNA Translation: EAL23871.1
CH471091 Genomic DNA Translation: EAW76650.1
CH236956 Genomic DNA Translation: EAL23870.1
CH471091 Genomic DNA Translation: EAW76651.1
BC000823 mRNA Translation: AAH00823.1
BC004288 mRNA Translation: AAH04288.1
BC007378 mRNA Translation: AAH07378.1
BC011816 mRNA Translation: AAH11816.1
BC024770 mRNA Translation: AAH24770.1
BC037407 mRNA Translation: AAH37407.1
CCDSiCCDS34695.1 [Q8N720-4]
CCDS47655.1 [Q8N720-3]
CCDS5669.1 [Q8N720-1]
CCDS5670.1 [Q8N720-2]
RefSeqiNP_001009958.1, NM_001009958.1 [Q8N720-4]
NP_001009960.1, NM_001009960.1 [Q8N720-1]
NP_001077425.1, NM_001083956.1 [Q8N720-3]
NP_001078835.1, NM_001085366.1 [Q8N720-4]
NP_001078836.1, NM_001085367.1 [Q8N720-2]
NP_001078837.1, NM_001085368.1 [Q8N720-3]
NP_076966.1, NM_024061.3 [Q8N720-2]
NP_612503.1, NM_138494.2 [Q8N720-1]
XP_016868092.1, XM_017012603.1 [Q8N720-3]
XP_016868093.1, XM_017012604.1 [Q8N720-3]
XP_016868095.1, XM_017012606.1 [Q8N720-1]
XP_016868096.1, XM_017012607.1 [Q8N720-1]
UniGeneiHs.599798

Genome annotation databases

EnsembliENST00000252713; ENSP00000252713; ENSG00000197343 [Q8N720-1]
ENST00000320583; ENSP00000322363; ENSG00000197343 [Q8N720-2]
ENST00000357864; ENSP00000350530; ENSG00000197343 [Q8N720-4]
ENST00000394163; ENSP00000377718; ENSG00000197343 [Q8N720-1]
ENST00000424881; ENSP00000393876; ENSG00000197343 [Q8N720-3]
ENST00000440391; ENSP00000396396; ENSG00000197343 [Q8N720-4]
ENST00000493277; ENSP00000419135; ENSG00000197343 [Q8N720-3]
GeneIDi79027
KEGGihsa:79027
UCSCiuc003urc.4 human [Q8N720-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN655_HUMAN
AccessioniPrimary (citable) accession number: Q8N720
Secondary accession number(s): A4D291
, A6NGD3, B4E3M4, B7Z9Q9, D6W5T4, Q8IV00, Q8TA89, Q96EZ3, Q9BQ85
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: October 17, 2006
Last modified: June 20, 2018
This is version 142 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health