Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (18 Sep 2019)
Sequence version 2 (27 Jan 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

ADP-ribosylation factor GTPase-activating protein 1

Gene

ARFGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri22 – 45C4-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
Biological processER-Golgi transport, Protein transport, Transport
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-8856828 Clathrin-mediated endocytosis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8N6T3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ADP-ribosylation factor GTPase-activating protein 1
Short name:
ARF GAP 1
Alternative name(s):
ADP-ribosylation factor 1 GTPase-activating protein
Short name:
ARF1 GAP
ARF1-directed GTPase-activating protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARFGAP1
Synonyms:ARF1GAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15852 ARFGAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608377 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N6T3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55738

Open Targets

More...
OpenTargetsi
ENSG00000101199

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164741246

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARFGAP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
27923731

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000741901 – 406ADP-ribosylation factor GTPase-activating protein 1Add BLAST406

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei135PhosphothreonineCombined sources1
Modified residuei150PhosphoserineCombined sources1
Modified residuei189PhosphothreonineCombined sources1
Modified residuei231N6-acetyllysineCombined sources1
Modified residuei246PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei343PhosphoserineCombined sources1
Modified residuei346PhosphoserineBy similarity1
Modified residuei348PhosphoserineBy similarity1
Modified residuei350PhosphothreonineCombined sources1
Modified residuei361PhosphoserineCombined sources1
Modified residuei363PhosphoserineBy similarity1
Modified residuei378PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N6T3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N6T3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N6T3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N6T3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N6T3

PeptideAtlas

More...
PeptideAtlasi
Q8N6T3

PRoteomics IDEntifications database

More...
PRIDEi
Q8N6T3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
18575
6951
72229 [Q8N6T3-1]
72230 [Q8N6T3-2]
72231 [Q8N6T3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N6T3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N6T3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8N6T3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101199 Expressed in 212 organ(s), highest expression level in adenohypophysis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N6T3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N6T3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051019
HPA056273

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ARF1.

Interacts with the COPI coat proteins, KDELR1 and TMED2. The interaction with TMED2 inhibits the GAP activity (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120856, 72 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N6T3, 56 interactors

Molecular INTeraction database

More...
MINTi
Q8N6T3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000314615

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1406
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N6T3

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8N6T3

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini7 – 124Arf-GAPPROSITE-ProRule annotationAdd BLAST118

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes (By similarity).By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri22 – 45C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0704 Eukaryota
COG5347 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00890000139515

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008494

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N6T3

KEGG Orthology (KO)

More...
KOi
K12492

Identification of Orthologs from Complete Genome Data

More...
OMAi
SVSMDTW

Database of Orthologous Groups

More...
OrthoDBi
1155557at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N6T3

TreeFam database of animal gene trees

More...
TreeFami
TF105931

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01412 ArfGap, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00405 REVINTRACTNG

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00105 ArfGap, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57863 SSF57863, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50115 ARFGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N6T3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPRTRKVL KEVRVQDENN VCFECGAFNP QWVSVTYGIW ICLECSGRHR
60 70 80 90 100
GLGVHLSFVR SVTMDKWKDI ELEKMKAGGN AKFREFLESQ EDYDPCWSLQ
110 120 130 140 150
EKYNSRAAAL FRDKVVALAE GREWSLESSP AQNWTPPQPR TLPSMVHRVS
160 170 180 190 200
GQPQSVTASS DKAFEDWLND DLGSYQGAQG NRYVGFGNTP PPQKKEDDFL
210 220 230 240 250
NNAMSSLYSG WSSFTTGASR FASAAKEGAT KFGSQASQKA SELGHSLNEN
260 270 280 290 300
VLKPAQEKVK EGKIFDDVSS GVSQLASKVQ GVGSKGWRDV TTFFSGKAEG
310 320 330 340 350
PLDSPSEGHS YQNSGLDHFQ NSNIDQSFWE TFGSAEPTKT RKSPSSDSWT
360 370 380 390 400
CADTSTERRS SDSWEVWGSA STNRNSNSDG GEGGEGTKKA VPPAVPTDDG

WDNQNW
Length:406
Mass (Da):44,668
Last modified:January 27, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCAE41828DE660621
GO
Isoform 2 (identifier: Q8N6T3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-239: K → KFWGHKQQPEP
     279-280: Missing.

Note: No experimental confirmation available.
Show »
Length:414
Mass (Da):45,676
Checksum:iBD081C6CE6CF0A18
GO
Isoform 3 (identifier: Q8N6T3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-406: VQGVGSKGWR...TDDGWDNQNW → CQRRLCCHQS...AVWTTSKTAT

Show »
Length:403
Mass (Da):44,467
Checksum:i0C695741E21D0F6F
GO
Isoform 4 (identifier: Q8N6T3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVS → MLSSESSWSLRRITILAGPCRRSTTAEPRPSLGI
     35-147: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):31,476
Checksum:iC0EEFC7461FF6CB3
GO
Isoform 5 (identifier: Q8N6T3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLS → MRTT
     239-239: K → KFWGHKQQPEP
     279-280: Missing.

Show »
Length:361
Mass (Da):39,705
Checksum:iD34FF3C257C7E8FB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RHC5E5RHC5_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWH9F8VWH9_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
340Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHH7E5RHH7_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGL6E5RGL6_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWB3F8VWB3_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIU2E5RIU2_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1U7F8W1U7_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIQ0H0YIQ0_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHT6E5RHT6_HUMAN
ADP-ribosylation factor GTPase-acti...
ARFGAP1
244Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB55009 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB55113 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAB70901 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti274Q → R in BAB55009 (PubMed:14702039).Curated1
Sequence conflicti358R → G in BAH12326 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_015187184V → M. Corresponds to variant dbSNP:rs2273499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0557391 – 57MASPR…GVHLS → MRTT in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0553791 – 34MASPR…PQWVS → MLSSESSWSLRRITILAGPC RRSTTAEPRPSLGI in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_05538035 – 147Missing in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_000298239K → KFWGHKQQPEP in isoform 2 and isoform 5. 2 Publications1
Alternative sequenceiVSP_021818279 – 406VQGVG…DNQNW → CQRRLCCHQSHCSAGHLGRA FCPVSWHEALCGQTGREEQA SLLPPKHVVGALEVCARGCP RCHVPHTPGTAAEWPGRLCL SRESVVRDGGTSPPFFRGKQ RAPWTAPRRATVIRTAVWTT SKTAT in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_000299279 – 280Missing in isoform 2 and isoform 5. 2 Publications2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001629 mRNA Translation: BAA91796.1
AK027268 mRNA Translation: BAB55009.1 Different initiation.
AK296351 mRNA Translation: BAH12326.1
AK027441 mRNA Translation: BAB55113.1 Different initiation.
AK303454 mRNA Translation: BAH13964.1
AL121827 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75292.1
CH471077 Genomic DNA Translation: EAW75294.1
BC000786 mRNA Translation: AAH00786.1
BC006085 mRNA Translation: AAH06085.1
BC011876 mRNA Translation: AAH11876.1
BC028233 mRNA Translation: AAH28233.1
AL137744 mRNA Translation: CAB70901.1 Sequence problems.
AB015340 mRNA Translation: BAA88117.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13515.1 [Q8N6T3-1]
CCDS13516.1 [Q8N6T3-2]
CCDS63326.1 [Q8N6T3-3]
CCDS63327.1 [Q8N6T3-5]
CCDS63328.1 [Q8N6T3-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46298

NCBI Reference Sequences

More...
RefSeqi
NP_001268411.1, NM_001281482.1 [Q8N6T3-3]
NP_001268412.1, NM_001281483.1 [Q8N6T3-5]
NP_001268413.1, NM_001281484.1 [Q8N6T3-4]
NP_060679.1, NM_018209.3 [Q8N6T3-1]
NP_783202.1, NM_175609.2 [Q8N6T3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000353546; ENSP00000314615; ENSG00000101199 [Q8N6T3-2]
ENST00000370275; ENSP00000359298; ENSG00000101199 [Q8N6T3-3]
ENST00000370283; ENSP00000359306; ENSG00000101199 [Q8N6T3-1]
ENST00000519273; ENSP00000443716; ENSG00000101199 [Q8N6T3-4]
ENST00000519604; ENSP00000430500; ENSG00000101199 [Q8N6T3-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55738

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55738

UCSC genome browser

More...
UCSCi
uc002yel.5 human [Q8N6T3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001629 mRNA Translation: BAA91796.1
AK027268 mRNA Translation: BAB55009.1 Different initiation.
AK296351 mRNA Translation: BAH12326.1
AK027441 mRNA Translation: BAB55113.1 Different initiation.
AK303454 mRNA Translation: BAH13964.1
AL121827 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75292.1
CH471077 Genomic DNA Translation: EAW75294.1
BC000786 mRNA Translation: AAH00786.1
BC006085 mRNA Translation: AAH06085.1
BC011876 mRNA Translation: AAH11876.1
BC028233 mRNA Translation: AAH28233.1
AL137744 mRNA Translation: CAB70901.1 Sequence problems.
AB015340 mRNA Translation: BAA88117.1
CCDSiCCDS13515.1 [Q8N6T3-1]
CCDS13516.1 [Q8N6T3-2]
CCDS63326.1 [Q8N6T3-3]
CCDS63327.1 [Q8N6T3-5]
CCDS63328.1 [Q8N6T3-4]
PIRiT46298
RefSeqiNP_001268411.1, NM_001281482.1 [Q8N6T3-3]
NP_001268412.1, NM_001281483.1 [Q8N6T3-5]
NP_001268413.1, NM_001281484.1 [Q8N6T3-4]
NP_060679.1, NM_018209.3 [Q8N6T3-1]
NP_783202.1, NM_175609.2 [Q8N6T3-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DWDX-ray2.40A/B1-128[»]
3O47X-ray2.80A/B1-140[»]
SMRiQ8N6T3
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120856, 72 interactors
IntActiQ8N6T3, 56 interactors
MINTiQ8N6T3
STRINGi9606.ENSP00000314615

PTM databases

iPTMnetiQ8N6T3
PhosphoSitePlusiQ8N6T3
SwissPalmiQ8N6T3

Polymorphism and mutation databases

BioMutaiARFGAP1
DMDMi27923731

Proteomic databases

EPDiQ8N6T3
jPOSTiQ8N6T3
MassIVEiQ8N6T3
MaxQBiQ8N6T3
PaxDbiQ8N6T3
PeptideAtlasiQ8N6T3
PRIDEiQ8N6T3
ProteomicsDBi18575
6951
72229 [Q8N6T3-1]
72230 [Q8N6T3-2]
72231 [Q8N6T3-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55738
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000353546; ENSP00000314615; ENSG00000101199 [Q8N6T3-2]
ENST00000370275; ENSP00000359298; ENSG00000101199 [Q8N6T3-3]
ENST00000370283; ENSP00000359306; ENSG00000101199 [Q8N6T3-1]
ENST00000519273; ENSP00000443716; ENSG00000101199 [Q8N6T3-4]
ENST00000519604; ENSP00000430500; ENSG00000101199 [Q8N6T3-5]
GeneIDi55738
KEGGihsa:55738
UCSCiuc002yel.5 human [Q8N6T3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55738
DisGeNETi55738

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARFGAP1
HGNCiHGNC:15852 ARFGAP1
HPAiHPA051019
HPA056273
MIMi608377 gene
neXtProtiNX_Q8N6T3
OpenTargetsiENSG00000101199
PharmGKBiPA164741246

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0704 Eukaryota
COG5347 LUCA
GeneTreeiENSGT00890000139515
HOGENOMiHOG000008494
InParanoidiQ8N6T3
KOiK12492
OMAiSVSMDTW
OrthoDBi1155557at2759
PhylomeDBiQ8N6T3
TreeFamiTF105931

Enzyme and pathway databases

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-8856828 Clathrin-mediated endocytosis
SIGNORiQ8N6T3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARFGAP1 human
EvolutionaryTraceiQ8N6T3

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ARFGAP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55738

Pharos

More...
Pharosi
Q8N6T3

Protein Ontology

More...
PROi
PR:Q8N6T3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101199 Expressed in 212 organ(s), highest expression level in adenohypophysis
ExpressionAtlasiQ8N6T3 baseline and differential
GenevisibleiQ8N6T3 HS

Family and domain databases

Gene3Di3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SUPFAMiSSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115 ARFGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARFG1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N6T3
Secondary accession number(s): B7Z3U0
, B7Z8H8, B7ZBI3, E1P5I9, E7EV62, Q6PK71, Q96KC4, Q96T02, Q9NSU3, Q9NVF6, Q9UIL0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 27, 2003
Last sequence update: January 27, 2003
Last modified: September 18, 2019
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again