Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ADP-ribosylation factor GTPase-activating protein 1

Gene

ARFGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri22 – 45C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

  • GTPase activator activity Source: MGI
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionGTPase activation
Biological processER-Golgi transport, Protein transport, Transport
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-8856828 Clathrin-mediated endocytosis
SIGNORiQ8N6T3

Names & Taxonomyi

Protein namesi
Recommended name:
ADP-ribosylation factor GTPase-activating protein 1
Short name:
ARF GAP 1
Alternative name(s):
ADP-ribosylation factor 1 GTPase-activating protein
Short name:
ARF1 GAP
ARF1-directed GTPase-activating protein
Gene namesi
Name:ARFGAP1
Synonyms:ARF1GAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000101199.12
HGNCiHGNC:15852 ARFGAP1
MIMi608377 gene
neXtProtiNX_Q8N6T3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Golgi apparatus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55738
OpenTargetsiENSG00000101199
PharmGKBiPA164741246

Polymorphism and mutation databases

DMDMi27923731

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000741901 – 406ADP-ribosylation factor GTPase-activating protein 1Add BLAST406

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei135PhosphothreonineCombined sources1
Modified residuei150PhosphoserineCombined sources1
Modified residuei189PhosphothreonineCombined sources1
Modified residuei231N6-acetyllysineCombined sources1
Modified residuei246PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei343PhosphoserineCombined sources1
Modified residuei346PhosphoserineBy similarity1
Modified residuei348PhosphoserineBy similarity1
Modified residuei350PhosphothreonineCombined sources1
Modified residuei361PhosphoserineCombined sources1
Modified residuei363PhosphoserineBy similarity1
Modified residuei378PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8N6T3
MaxQBiQ8N6T3
PaxDbiQ8N6T3
PeptideAtlasiQ8N6T3
PRIDEiQ8N6T3
ProteomicsDBi72229
72230 [Q8N6T3-2]
72231 [Q8N6T3-3]

PTM databases

iPTMnetiQ8N6T3
PhosphoSitePlusiQ8N6T3

Expressioni

Gene expression databases

BgeeiENSG00000101199
CleanExiHS_ARFGAP1
ExpressionAtlasiQ8N6T3 baseline and differential
GenevisibleiQ8N6T3 HS

Organism-specific databases

HPAiHPA051019
HPA056273

Interactioni

Subunit structurei

Interacts with ARF1. Interacts with the COPI coat proteins, KDELR1 and TMED2. The interaction with TMED2 inhibits the GAP activity (By similarity).By similarity

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi120856, 70 interactors
IntActiQ8N6T3, 30 interactors
MINTiQ8N6T3
STRINGi9606.ENSP00000314615

Structurei

Secondary structure

1406
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi4 – 14Combined sources11
Turni17 – 20Combined sources4
Turni23 – 25Combined sources3
Beta strandi32 – 34Combined sources3
Turni35 – 38Combined sources4
Beta strandi39 – 41Combined sources3
Helixi43 – 52Combined sources10
Turni54 – 56Combined sources3
Beta strandi59 – 62Combined sources4
Helixi69 – 77Combined sources9
Helixi80 – 88Combined sources9
Helixi99 – 103Combined sources5
Helixi106 – 119Combined sources14

3D structure databases

ProteinModelPortaliQ8N6T3
SMRiQ8N6T3
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N6T3

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 124Arf-GAPPROSITE-ProRule annotationAdd BLAST118

Domaini

The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes (By similarity).By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri22 – 45C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0704 Eukaryota
COG5347 LUCA
GeneTreeiENSGT00890000139515
HOGENOMiHOG000008494
HOVERGENiHBG050562
InParanoidiQ8N6T3
KOiK12492
OMAiGWDNQNW
OrthoDBiEOG091G0DQ3
PhylomeDBiQ8N6T3
TreeFamiTF105931

Family and domain databases

Gene3Di3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SUPFAMiSSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115 ARFGAP, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N6T3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPRTRKVL KEVRVQDENN VCFECGAFNP QWVSVTYGIW ICLECSGRHR
60 70 80 90 100
GLGVHLSFVR SVTMDKWKDI ELEKMKAGGN AKFREFLESQ EDYDPCWSLQ
110 120 130 140 150
EKYNSRAAAL FRDKVVALAE GREWSLESSP AQNWTPPQPR TLPSMVHRVS
160 170 180 190 200
GQPQSVTASS DKAFEDWLND DLGSYQGAQG NRYVGFGNTP PPQKKEDDFL
210 220 230 240 250
NNAMSSLYSG WSSFTTGASR FASAAKEGAT KFGSQASQKA SELGHSLNEN
260 270 280 290 300
VLKPAQEKVK EGKIFDDVSS GVSQLASKVQ GVGSKGWRDV TTFFSGKAEG
310 320 330 340 350
PLDSPSEGHS YQNSGLDHFQ NSNIDQSFWE TFGSAEPTKT RKSPSSDSWT
360 370 380 390 400
CADTSTERRS SDSWEVWGSA STNRNSNSDG GEGGEGTKKA VPPAVPTDDG

WDNQNW
Length:406
Mass (Da):44,668
Last modified:January 27, 2003 - v2
Checksum:iCAE41828DE660621
GO
Isoform 2 (identifier: Q8N6T3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     239-239: K → KFWGHKQQPEP
     279-280: Missing.

Note: No experimental confirmation available.
Show »
Length:414
Mass (Da):45,676
Checksum:iBD081C6CE6CF0A18
GO
Isoform 3 (identifier: Q8N6T3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     279-406: VQGVGSKGWR...TDDGWDNQNW → CQRRLCCHQS...AVWTTSKTAT

Show »
Length:403
Mass (Da):44,467
Checksum:i0C695741E21D0F6F
GO
Isoform 4 (identifier: Q8N6T3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVS → MLSSESSWSLRRITILAGPCRRSTTAEPRPSLGI
     35-147: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):31,476
Checksum:iC0EEFC7461FF6CB3
GO
Isoform 5 (identifier: Q8N6T3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLS → MRTT
     239-239: K → KFWGHKQQPEP
     279-280: Missing.

Show »
Length:361
Mass (Da):39,705
Checksum:iD34FF3C257C7E8FB
GO

Sequence cautioni

The sequence BAB55009 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB55113 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAB70901 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti274Q → R in BAB55009 (PubMed:14702039).Curated1
Sequence conflicti358R → G in BAH12326 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_015187184V → M. Corresponds to variant dbSNP:rs2273499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0557391 – 57MASPR…GVHLS → MRTT in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0553791 – 34MASPR…PQWVS → MLSSESSWSLRRITILAGPC RRSTTAEPRPSLGI in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_05538035 – 147Missing in isoform 4. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_000298239K → KFWGHKQQPEP in isoform 2 and isoform 5. 2 Publications1
Alternative sequenceiVSP_021818279 – 406VQGVG…DNQNW → CQRRLCCHQSHCSAGHLGRA FCPVSWHEALCGQTGREEQA SLLPPKHVVGALEVCARGCP RCHVPHTPGTAAEWPGRLCL SRESVVRDGGTSPPFFRGKQ RAPWTAPRRATVIRTAVWTT SKTAT in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_000299279 – 280Missing in isoform 2 and isoform 5. 2 Publications2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001629 mRNA Translation: BAA91796.1
AK027268 mRNA Translation: BAB55009.1 Different initiation.
AK296351 mRNA Translation: BAH12326.1
AK027441 mRNA Translation: BAB55113.1 Different initiation.
AK303454 mRNA Translation: BAH13964.1
AL121827 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75292.1
CH471077 Genomic DNA Translation: EAW75294.1
BC000786 mRNA Translation: AAH00786.1
BC006085 mRNA Translation: AAH06085.1
BC011876 mRNA Translation: AAH11876.1
BC028233 mRNA Translation: AAH28233.1
AL137744 mRNA Translation: CAB70901.1 Sequence problems.
AB015340 mRNA Translation: BAA88117.1
CCDSiCCDS13515.1 [Q8N6T3-1]
CCDS13516.1 [Q8N6T3-2]
CCDS63326.1 [Q8N6T3-3]
CCDS63327.1 [Q8N6T3-5]
CCDS63328.1 [Q8N6T3-4]
PIRiT46298
RefSeqiNP_001268411.1, NM_001281482.1 [Q8N6T3-3]
NP_001268412.1, NM_001281483.1 [Q8N6T3-5]
NP_001268413.1, NM_001281484.1 [Q8N6T3-4]
NP_060679.1, NM_018209.3 [Q8N6T3-1]
NP_783202.1, NM_175609.2 [Q8N6T3-2]
UniGeneiHs.25584

Genome annotation databases

EnsembliENST00000353546; ENSP00000314615; ENSG00000101199 [Q8N6T3-2]
ENST00000370275; ENSP00000359298; ENSG00000101199 [Q8N6T3-3]
ENST00000370283; ENSP00000359306; ENSG00000101199 [Q8N6T3-1]
ENST00000519273; ENSP00000443716; ENSG00000101199 [Q8N6T3-4]
ENST00000519604; ENSP00000430500; ENSG00000101199 [Q8N6T3-5]
GeneIDi55738
KEGGihsa:55738
UCSCiuc002yel.5 human [Q8N6T3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiARFG1_HUMAN
AccessioniPrimary (citable) accession number: Q8N6T3
Secondary accession number(s): B7Z3U0
, B7Z8H8, B7ZBI3, E1P5I9, E7EV62, Q6PK71, Q96KC4, Q96T02, Q9NSU3, Q9NVF6, Q9UIL0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 27, 2003
Last sequence update: January 27, 2003
Last modified: July 18, 2018
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health