Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (16 Oct 2019)
Sequence version 3 (11 May 2016)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Type 2 DNA topoisomerase 6 subunit B-like

Gene

TOP6BL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 3: Component of a topoisomerase 6 complex specifically required for meiotic recombination. Together with SPO11, mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. The complex promotes relaxation of negative and positive supercoiled DNA and DNA decatenation through cleavage and ligation cycles.By similarity

Miscellaneous

Expansion of a polymorphic CGG repeat within the 5'-UTR of this gene may be the cause of folate-sensitive fragile site FRA11A. The expansion is identified in the 15-year-old proband with mental retardation as well as in phenotypically normal members of the family.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processMeiosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Type 2 DNA topoisomerase 6 subunit B-likeBy similarity
Alternative name(s):
Type 2 DNA topoisomerase VI subunit B-likeBy similarity
Short name:
TOPOVIBLBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TOP6BL1 Publication
Synonyms:C11orf80Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26197 C11orf80

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616109 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N6T0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79703

MalaCards human disease database

More...
MalaCardsi
C11orf80

Open Targets

More...
OpenTargetsi
ENSG00000173715

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
254688 Complete hydatidiform mole

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162377704

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N6T0

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C11orf80

Domain mapping of disease mutations (DMDM)

More...
DMDMi
519668662

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002966221 – 577Type 2 DNA topoisomerase 6 subunit B-likeAdd BLAST577

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N6T0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N6T0

PeptideAtlas

More...
PeptideAtlasi
Q8N6T0

PRoteomics IDEntifications database

More...
PRIDEi
Q8N6T0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72226 [Q8N6T0-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N6T0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N6T0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in lung, spleen,colon and in skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173715 Expressed in 124 organ(s), highest expression level in skin of abdomen

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N6T0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N6T0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038932
HPA038933

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 3: Heterotetramer of SPO11 and 2 TOP6BL chains. Isoform 3:

Interacts with SPO11.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122822, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354227

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform 3: Despite a weak sequence similarity, retains most of the structural features of the ancestral archaeal Top6B subunit (AC O05207), including the transducer domain that interacts with the SPO11 subunit and the ATP-binding fold, also named GHKL fold.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TOP6B-like family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGZ1 Eukaryota
ENOG410YW9Q LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009327

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168638

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N6T0

Identification of Orthologs from Complete Genome Data

More...
OMAi
CPCPKVF

Database of Orthologous Groups

More...
OrthoDBi
1458907at2759

TreeFam database of animal gene trees

More...
TreeFami
TF337039

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028040 TopoVIB-like

The PANTHER Classification System

More...
PANTHERi
PTHR14652 PTHR14652, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15091 DUF4554, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q8N6T0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGTAVAVFE ILRFLIIHWK CDIDVSKGAL LEGQLVISIE GLNSKHQANA
60 70 80 90 100
LHCVTTVASA GSLFGGMVLK KFLKEIQSIL PGISAKLTWT SEEGSYSQDM
110 120 130 140 150
TGVTPFQMIF EVDEKPRTLM TDCLVIKHFL RKIIMVHPKV RFHFSVKVNG
160 170 180 190 200
ILSTEIFGVE NEPTLNLGNG IALLVDSQHY VRPNFGTIES HCSRIHPVLG
210 220 230 240 250
HPVMLFIPED VAGMDLLGEL ILTPAAALCP SPKVSSNQLN RISSVSIFLY
260 270 280 290 300
GPLGLPLILS TWEQPMTTFF KDTSSLVDWK KYHLCMIPNL DLNLDRDLVL
310 320 330 340 350
PDVSYQVESS EEDQSQTMDP QGQTLLLFLF VDFHSAFPVQ QMEIWGVYTL
360 370 380 390 400
LTTHLNAILV ESHSVVQGSI QFTVDKVLEQ HHQAAKAQQK LQASLSVAVN
410 420 430 440 450
SIMSILTGST RSSFRKMCLQ TLQAADTQEF RTKLHKVFRE ITQHQFLHHC
460 470 480 490 500
SCEVKQQLTL EKKDSAQGTE DAPDNSSLEL LADTSGQAEN KRLKRGSPRI
510 520 530 540 550
EEMRALRSAR APSPSEAAPR RPEATAAPLT PRGREHREAH GRALAPGRAS
560 570
LGSRLEDVLW LQEVSNLSEW LSPSPGP
Note: No experimental confirmation available.
Length:577
Mass (Da):64,047
Last modified:May 11, 2016 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CA7E34C0E212484
GO
Isoform 1 (identifier: Q8N6T0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGSRCRAWAWTRAWALAEFQARAEEGAAAAAAAAGGYPSTGRCRCSLRGM
     56-56: T → TRWSLTLLPRPECSGAVSAHCNLHLPGSSDSHASVPRVAGITDAHHHAWLIM

Note: Contains a signal peptide sequence at position 1-23.Sequence analysis
Show »
Length:677
Mass (Da):74,636
Checksum:iBA61390D27B9612F
GO
Isoform 2 (identifier: Q8N6T0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-56: T → TRWSLTLLPRPECSGAVSAHCNLHLPGSSDSHASVPRVAGITDAHHHAWLIM
     387-423: Missing.

Show »
Length:591
Mass (Da):65,512
Checksum:i6762F4EE3BCAF491
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DXL1B4DXL1_HUMAN
Chromosome 11 open reading frame 80
C11orf80
511Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKM2E9PKM2_HUMAN
Chromosome 11 open reading frame 80
C11orf80
460Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YE21H0YE21_HUMAN
Chromosome 11 open reading frame 80
C11orf80
459Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD55H0YD55_HUMAN
Chromosome 11 open reading frame 80
C11orf80
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA08A0A140TA08_HUMAN
Chromosome 11 open reading frame 80
C11orf80
485Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5A2A0A2R8Y5A2_HUMAN
Chromosome 11 open reading frame 80
C11orf80
577Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZP7A0A2U3TZP7_HUMAN
Chromosome 11 open reading frame 80
C11orf80
628Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMI8E9PMI8_HUMAN
Chromosome 11 open reading frame 80
C11orf80
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD22H0YD22_HUMAN
Chromosome 11 open reading frame 80
C11orf80
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJS1E9PJS1_HUMAN
Chromosome 11 open reading frame 80
C11orf80
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH28240 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB15387 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0583301M → MGSRCRAWAWTRAWALAEFQ ARAEEGAAAAAAAAGGYPST GRCRCSLRGM in isoform 1. 1 Publication1
Alternative sequenceiVSP_05833156T → TRWSLTLLPRPECSGAVSAH CNLHLPGSSDSHASVPRVAG ITDAHHHAWLIM in isoform 1 and isoform 2. 2 Publications1
Alternative sequenceiVSP_058332387 – 423Missing in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AP000485 Genomic DNA No translation available.
AP001157 Genomic DNA No translation available.
BC028240 mRNA Translation: AAH28240.1 Different initiation.
AK026184 mRNA Translation: BAB15387.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53664.1 [Q8N6T0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001289013.1, NM_001302084.1
NP_078926.3, NM_024650.3 [Q8N6T0-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360962; ENSP00000354227; ENSG00000173715 [Q8N6T0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79703

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79703

UCSC genome browser

More...
UCSCi
uc021qmd.2 human [Q8N6T0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AP000485 Genomic DNA No translation available.
AP001157 Genomic DNA No translation available.
BC028240 mRNA Translation: AAH28240.1 Different initiation.
AK026184 mRNA Translation: BAB15387.1 Different initiation.
CCDSiCCDS53664.1 [Q8N6T0-4]
RefSeqiNP_001289013.1, NM_001302084.1
NP_078926.3, NM_024650.3 [Q8N6T0-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi122822, 1 interactor
STRINGi9606.ENSP00000354227

PTM databases

iPTMnetiQ8N6T0
PhosphoSitePlusiQ8N6T0

Polymorphism and mutation databases

BioMutaiC11orf80
DMDMi519668662

Proteomic databases

EPDiQ8N6T0
jPOSTiQ8N6T0
PeptideAtlasiQ8N6T0
PRIDEiQ8N6T0
ProteomicsDBi72226 [Q8N6T0-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79703

Genome annotation databases

EnsembliENST00000360962; ENSP00000354227; ENSG00000173715 [Q8N6T0-4]
GeneIDi79703
KEGGihsa:79703
UCSCiuc021qmd.2 human [Q8N6T0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79703
DisGeNETi79703

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C11orf80
HGNCiHGNC:26197 C11orf80
HPAiHPA038932
HPA038933
MalaCardsiC11orf80
MIMi616109 gene
neXtProtiNX_Q8N6T0
OpenTargetsiENSG00000173715
Orphaneti254688 Complete hydatidiform mole
PharmGKBiPA162377704

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGZ1 Eukaryota
ENOG410YW9Q LUCA
GeneTreeiENSGT00390000009327
HOGENOMiHOG000168638
InParanoidiQ8N6T0
OMAiCPCPKVF
OrthoDBi1458907at2759
TreeFamiTF337039

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C11orf80 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79703
PharosiQ8N6T0

Protein Ontology

More...
PROi
PR:Q8N6T0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173715 Expressed in 124 organ(s), highest expression level in skin of abdomen
ExpressionAtlasiQ8N6T0 baseline and differential
GenevisibleiQ8N6T0 HS

Family and domain databases

InterProiView protein in InterPro
IPR028040 TopoVIB-like
PANTHERiPTHR14652 PTHR14652, 1 hit
PfamiView protein in Pfam
PF15091 DUF4554, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTO6BL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N6T0
Secondary accession number(s): Q9H677
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: May 11, 2016
Last modified: October 16, 2019
This is version 106 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again