Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8N6S4 (AN13C_HUMAN)

Entry version 135 (13 Feb 2019)
Sequence version 2 (27 Jun 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ankyrin repeat domain-containing protein 13C

Gene

ANKRD13C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor binding Source: BHF-UCL
View the complete GO annotation on QuickGO ...

GO - Biological processi

  • protein retention in ER lumen Source: BHF-UCL
  • regulation of anoikis Source: BHF-UCL
  • regulation of receptor biosynthetic process Source: BHF-UCL
View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 13C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKRD13C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000118454.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:25374 ANKRD13C

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		615125 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N6S4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000118454

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142672617

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ANKRD13C

Domain mapping of disease mutations (DMDM)

More...DMDMi		109940205

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002406451 – 541Ankyrin repeat domain-containing protein 13CAdd BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei411PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8N6S4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N6S4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N6S4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8N6S4

PeptideAtlas

More...PeptideAtlasi		Q8N6S4

PRoteomics IDEntifications database

More...PRIDEi		Q8N6S4

ProteomicsDB human proteome resource

More...ProteomicsDBi		72222
72223 [Q8N6S4-2]
72224 [Q8N6S4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N6S4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N6S4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000118454 Expressed in 196 organ(s), highest expression level in corpus callosum

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N6S4 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		123534, 11 interactors

Protein interaction database and analysis system

More...IntActi		Q8N6S4, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000359982

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q8N6S4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8N6S4

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati111 – 142ANK 1Add BLAST32
Repeati143 – 172ANK 2Add BLAST30
Repeati176 – 205ANK 3Add BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi30 – 33Poly-Ala4

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0522 Eukaryota
ENOG410XNMS LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153646

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000007095

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG079639

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N6S4

KEGG Orthology (KO)

More...KOi		K21437

Identification of Orthologs from Complete Genome Data

More...OMAi		YPMHQSV

Database of Orthologous Groups

More...OrthoDBi		425969at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N6S4

TreeFam database of animal gene trees

More...TreeFami		TF314176

Family and domain databases

Conserved Domains Database

More...CDDi		cd00204 ANK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021832 ANKRD13
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf

The PANTHER Classification System

More...PANTHERi		PTHR12447 PTHR12447, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12796 Ank_2, 1 hit
PF11904 GPCR_chapero_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00248 ANK, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N6S4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGEKIRSLR RDHKPSKEEG DLLEPGDEEA AAALGGTFTR SRIGKGGKAC 
        60         70         80         90        100
HKIFSNHHHR LQLKAAPASS NPPGAPALPL HNSSVTANSQ SPALLAGTNP 
       110        120        130        140        150
VAVVADGGSC PAHYPVHECV FKGDVRRLSS LIRTHNIGQK DNHGNTPLHL 
       160        170        180        190        200
AVMLGNKECA HLLLAHNAPV KVKNAQGWSP LAEAISYGDR QMITALLRKL 
       210        220        230        240        250
KQQSRESVEE KRPRLLKALK ELGDFYLELH WDFQSWVPLL SRILPSDACK 
       260        270        280        290        300
IYKQGINIRL DTTLIDFTDM KCQRGDLSFI FNGDAAPSES FVVLDNEQKV 
       310        320        330        340        350
YQRIHHEESE METEEEVDIL MSSDIYSATL STKSISFTRA QTGWLFREDK 
       360        370        380        390        400
TERVGNFLAD FYLVNGLVLE SRKRREHLSE EDILRNKAIM ESLSKGGNIM 
       410        420        430        440        450
EQNFEPIRRQ SLTPPPQNTI TWEEYISAEN GKAPHLGREL VCKESKKTFK 
       460        470        480        490        500
ATIAMSQEFP LGIELLLNVL EVVAPFKHFN KLREFVQMKL PPGFPVKLDI 
       510        520        530        540 
PVFPTITATV TFQEFRYDEF DGSIFTIPDD YKEDPSRFPD L
Length:541
Mass (Da):60,818
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0215707FDFB92046
GO
Isoform 2 (identifier: Q8N6S4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-193: ECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMI → V

Note: No experimental confirmation available.
Show »
Length:506
Mass (Da):57,003
Checksum:iC907ED83B395E6BB
GO
Isoform 3 (identifier: Q8N6S4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-147: NTP → EEC
     148-541: Missing.

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):15,550
Checksum:iCC81CA5B6D459960
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG51959 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti369L → I in CAB66651 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026825413T → S1 PublicationCorresponds to variant dbSNP:rs17852616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019406145 – 147NTP → EEC in isoform 3. 1 Publication3
Alternative sequenceiVSP_019407148 – 541Missing in isoform 3. 1 PublicationAdd BLAST394
Alternative sequenceiVSP_019408158 – 193ECAHL…DRQMI → V in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL136717 mRNA Translation: CAB66651.1
AL158839 Genomic DNA No translation available.
AL353771 Genomic DNA No translation available.
AL354721 Genomic DNA No translation available.
BC016937 mRNA Translation: AAH16937.1
BC028840 mRNA Translation: AAH28840.1
AK074187 mRNA Translation: BAG51959.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS648.2 [Q8N6S4-1]

NCBI Reference Sequences

More...RefSeqi		NP_110443.3, NM_030816.4 [Q8N6S4-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.744989

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262346; ENSP00000262346; ENSG00000118454 [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454 [Q8N6S4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		81573

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:81573

UCSC genome browser

More...UCSCi		uc001dex.5 human [Q8N6S4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136717 mRNA Translation: CAB66651.1
AL158839 Genomic DNA No translation available.
AL353771 Genomic DNA No translation available.
AL354721 Genomic DNA No translation available.
BC016937 mRNA Translation: AAH16937.1
BC028840 mRNA Translation: AAH28840.1
AK074187 mRNA Translation: BAG51959.1 Different initiation.
CCDSiCCDS648.2 [Q8N6S4-1]
RefSeqiNP_110443.3, NM_030816.4 [Q8N6S4-1]
UniGeneiHs.744989

3D structure databases

ProteinModelPortaliQ8N6S4
SMRiQ8N6S4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123534, 11 interactors
IntActiQ8N6S4, 1 interactor
STRINGi9606.ENSP00000359982

PTM databases

iPTMnetiQ8N6S4
PhosphoSitePlusiQ8N6S4

Polymorphism and mutation databases

BioMutaiANKRD13C
DMDMi109940205

Proteomic databases

EPDiQ8N6S4
jPOSTiQ8N6S4
MaxQBiQ8N6S4
PaxDbiQ8N6S4
PeptideAtlasiQ8N6S4
PRIDEiQ8N6S4
ProteomicsDBi72222
72223 [Q8N6S4-2]
72224 [Q8N6S4-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		81573
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262346; ENSP00000262346; ENSG00000118454 [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454 [Q8N6S4-1]
GeneIDi81573
KEGGihsa:81573
UCSCiuc001dex.5 human [Q8N6S4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		81573
EuPathDBiHostDB:ENSG00000118454.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		ANKRD13C

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0000694
HGNCiHGNC:25374 ANKRD13C
MIMi615125 gene
neXtProtiNX_Q8N6S4
OpenTargetsiENSG00000118454
PharmGKBiPA142672617

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0522 Eukaryota
ENOG410XNMS LUCA
GeneTreeiENSGT00940000153646
HOGENOMiHOG000007095
HOVERGENiHBG079639
InParanoidiQ8N6S4
KOiK21437
OMAiYPMHQSV
OrthoDBi425969at2759
PhylomeDBiQ8N6S4
TreeFamiTF314176

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ANKRD13C human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ANKRD13C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		81573

Protein Ontology

More...PROi		PR:Q8N6S4

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000118454 Expressed in 196 organ(s), highest expression level in corpus callosum
GenevisibleiQ8N6S4 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR021832 ANKRD13
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PANTHERiPTHR12447 PTHR12447, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF11904 GPCR_chapero_1, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 2 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAN13C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N6S4
Secondary accession number(s): B3KQ97
, Q5VYH4, Q5VYH5, Q6PJE4, Q9H0N9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: February 13, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again