Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (13 Feb 2019)
Sequence version 2 (27 Jun 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ankyrin repeat domain-containing protein 13C

Gene

ANKRD13C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor binding Source: BHF-UCL

GO - Biological processi

  • protein retention in ER lumen Source: BHF-UCL
  • regulation of anoikis Source: BHF-UCL
  • regulation of receptor biosynthetic process Source: BHF-UCL

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 13C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000118454.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25374 ANKRD13C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615125 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N6S4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000118454

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672617

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKRD13C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
109940205

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002406451 – 541Ankyrin repeat domain-containing protein 13CAdd BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei411PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N6S4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N6S4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N6S4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N6S4

PeptideAtlas

More...
PeptideAtlasi
Q8N6S4

PRoteomics IDEntifications database

More...
PRIDEi
Q8N6S4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
72222
72223 [Q8N6S4-2]
72224 [Q8N6S4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N6S4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N6S4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118454 Expressed in 196 organ(s), highest expression level in corpus callosum

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N6S4 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123534, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N6S4, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359982

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8N6S4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N6S4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati111 – 142ANK 1Add BLAST32
Repeati143 – 172ANK 2Add BLAST30
Repeati176 – 205ANK 3Add BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi30 – 33Poly-Ala4

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0522 Eukaryota
ENOG410XNMS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153646

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007095

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079639

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N6S4

KEGG Orthology (KO)

More...
KOi
K21437

Identification of Orthologs from Complete Genome Data

More...
OMAi
YPMHQSV

Database of Orthologous Groups

More...
OrthoDBi
425969at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N6S4

TreeFam database of animal gene trees

More...
TreeFami
TF314176

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021832 ANKRD13
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12447 PTHR12447, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 1 hit
PF11904 GPCR_chapero_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N6S4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGEKIRSLR RDHKPSKEEG DLLEPGDEEA AAALGGTFTR SRIGKGGKAC
60 70 80 90 100
HKIFSNHHHR LQLKAAPASS NPPGAPALPL HNSSVTANSQ SPALLAGTNP
110 120 130 140 150
VAVVADGGSC PAHYPVHECV FKGDVRRLSS LIRTHNIGQK DNHGNTPLHL
160 170 180 190 200
AVMLGNKECA HLLLAHNAPV KVKNAQGWSP LAEAISYGDR QMITALLRKL
210 220 230 240 250
KQQSRESVEE KRPRLLKALK ELGDFYLELH WDFQSWVPLL SRILPSDACK
260 270 280 290 300
IYKQGINIRL DTTLIDFTDM KCQRGDLSFI FNGDAAPSES FVVLDNEQKV
310 320 330 340 350
YQRIHHEESE METEEEVDIL MSSDIYSATL STKSISFTRA QTGWLFREDK
360 370 380 390 400
TERVGNFLAD FYLVNGLVLE SRKRREHLSE EDILRNKAIM ESLSKGGNIM
410 420 430 440 450
EQNFEPIRRQ SLTPPPQNTI TWEEYISAEN GKAPHLGREL VCKESKKTFK
460 470 480 490 500
ATIAMSQEFP LGIELLLNVL EVVAPFKHFN KLREFVQMKL PPGFPVKLDI
510 520 530 540
PVFPTITATV TFQEFRYDEF DGSIFTIPDD YKEDPSRFPD L
Length:541
Mass (Da):60,818
Last modified:June 27, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0215707FDFB92046
GO
Isoform 2 (identifier: Q8N6S4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     158-193: ECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMI → V

Note: No experimental confirmation available.
Show »
Length:506
Mass (Da):57,003
Checksum:iC907ED83B395E6BB
GO
Isoform 3 (identifier: Q8N6S4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-147: NTP → EEC
     148-541: Missing.

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):15,550
Checksum:iCC81CA5B6D459960
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG51959 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti369L → I in CAB66651 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026825413T → S1 PublicationCorresponds to variant dbSNP:rs17852616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019406145 – 147NTP → EEC in isoform 3. 1 Publication3
Alternative sequenceiVSP_019407148 – 541Missing in isoform 3. 1 PublicationAdd BLAST394
Alternative sequenceiVSP_019408158 – 193ECAHL…DRQMI → V in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136717 mRNA Translation: CAB66651.1
AL158839 Genomic DNA No translation available.
AL353771 Genomic DNA No translation available.
AL354721 Genomic DNA No translation available.
BC016937 mRNA Translation: AAH16937.1
BC028840 mRNA Translation: AAH28840.1
AK074187 mRNA Translation: BAG51959.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS648.2 [Q8N6S4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_110443.3, NM_030816.4 [Q8N6S4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.744989

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262346; ENSP00000262346; ENSG00000118454 [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454 [Q8N6S4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
81573

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:81573

UCSC genome browser

More...
UCSCi
uc001dex.5 human [Q8N6S4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136717 mRNA Translation: CAB66651.1
AL158839 Genomic DNA No translation available.
AL353771 Genomic DNA No translation available.
AL354721 Genomic DNA No translation available.
BC016937 mRNA Translation: AAH16937.1
BC028840 mRNA Translation: AAH28840.1
AK074187 mRNA Translation: BAG51959.1 Different initiation.
CCDSiCCDS648.2 [Q8N6S4-1]
RefSeqiNP_110443.3, NM_030816.4 [Q8N6S4-1]
UniGeneiHs.744989

3D structure databases

ProteinModelPortaliQ8N6S4
SMRiQ8N6S4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123534, 11 interactors
IntActiQ8N6S4, 1 interactor
STRINGi9606.ENSP00000359982

PTM databases

iPTMnetiQ8N6S4
PhosphoSitePlusiQ8N6S4

Polymorphism and mutation databases

BioMutaiANKRD13C
DMDMi109940205

Proteomic databases

EPDiQ8N6S4
jPOSTiQ8N6S4
MaxQBiQ8N6S4
PaxDbiQ8N6S4
PeptideAtlasiQ8N6S4
PRIDEiQ8N6S4
ProteomicsDBi72222
72223 [Q8N6S4-2]
72224 [Q8N6S4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
81573
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262346; ENSP00000262346; ENSG00000118454 [Q8N6S4-2]
ENST00000370944; ENSP00000359982; ENSG00000118454 [Q8N6S4-1]
GeneIDi81573
KEGGihsa:81573
UCSCiuc001dex.5 human [Q8N6S4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81573
EuPathDBiHostDB:ENSG00000118454.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKRD13C

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0000694
HGNCiHGNC:25374 ANKRD13C
MIMi615125 gene
neXtProtiNX_Q8N6S4
OpenTargetsiENSG00000118454
PharmGKBiPA142672617

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0522 Eukaryota
ENOG410XNMS LUCA
GeneTreeiENSGT00940000153646
HOGENOMiHOG000007095
HOVERGENiHBG079639
InParanoidiQ8N6S4
KOiK21437
OMAiYPMHQSV
OrthoDBi425969at2759
PhylomeDBiQ8N6S4
TreeFamiTF314176

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKRD13C human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANKRD13C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
81573

Protein Ontology

More...
PROi
PR:Q8N6S4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000118454 Expressed in 196 organ(s), highest expression level in corpus callosum
GenevisibleiQ8N6S4 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR021832 ANKRD13
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PANTHERiPTHR12447 PTHR12447, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF11904 GPCR_chapero_1, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 2 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAN13C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N6S4
Secondary accession number(s): B3KQ97
, Q5VYH4, Q5VYH5, Q6PJE4, Q9H0N9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: February 13, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again