Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (02 Jun 2021)
Sequence version 3 (05 May 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Meiosis-specific with OB domain-containing protein

Gene

MEIOB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Single-stranded DNA-binding protein required for homologous recombination in meiosis I. Required for double strand breaks (DSBs) repair and crossover formation and promotion of faithful and complete synapsis. Not required for the initial loading of recombinases but required to maintain a proper number of RAD51 and DMC1 foci after the zygotene stage. May act by ensuring the stabilization of recombinases, which is required for successful homology search and meiotic recombination. Displays Single-stranded DNA 3'-5' exonuclease activity in vitro.

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi167 – 272OBAdd BLAST106

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Exonuclease, Hydrolase, Nuclease
Biological processMeiosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N635

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Meiosis-specific with OB domain-containing proteinCurated (EC:3.1.-.-)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MEIOBImported
Synonyms:C16orf73
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28569, MEIOB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617670, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N635

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000162039.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spermatogenic failure 22 (SPGF22)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn infertility disorder caused by spermatogenesis defects that result in non-obstructive azoospermia.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08003464N → I in SPGF22. 1 PublicationCorresponds to variant dbSNP:rs1555472691EnsemblClinVar.1

Organism-specific databases

DisGeNET

More...
DisGeNETi
254528

MalaCards human disease database

More...
MalaCardsi
MEIOB
MIMi617706, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000162039

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
399805, Male infertility with azoospermia or oligozoospermia due to single gene mutation

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145149601

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N635, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MEIOB

Domain mapping of disease mutations (DMDM)

More...
DMDMi
229462984

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003371341 – 442Meiosis-specific with OB domain-containing proteinAdd BLAST442

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N635

PeptideAtlas

More...
PeptideAtlasi
Q8N635

PRoteomics IDEntifications database

More...
PRIDEi
Q8N635

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72128 [Q8N635-1]
7972

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N635

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N635

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In fetal gonads, specifically expressed in the ovary starting at the 14th weeks post fertilization (PubMed:24068956). In the adult, restricted to testis (PubMed:28206990).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162039, Expressed in right testis and 106 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N635, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N635, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162039, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a multiprotein complex with RPA2 and SPATA22.

Interacts with the complex BRME1:HSF2BP:BRCA2.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
129038, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N635, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000390778

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N635, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MEIOB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0851, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001723

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_042457_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N635

Identification of Orthologs from Complete Genome Data

More...
OMAi
WGQRACV

Database of Orthologous Groups

More...
OrthoDBi
615895at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N635

TreeFam database of animal gene trees

More...
TreeFami
TF323670

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012340, NA-bd_OB-fold

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50249, SSF50249, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N635-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANSFAARIF TTLSDLQTNM ANLKVIGIVI GKTDVKGFPD RKNIGSERYT
60 70 80 90 100
FSFTIRDSPA HFVNAASWGN EDYIKSLSDS FRVGDCVIIE NPLIQRKEIE
110 120 130 140 150
REEKFSPATP SNCKLLLSEN HSTVKVCSSY EVDTKLLSLI HLPVKESHDY
160 170 180 190 200
YSLGDIVANG HSLNGRIINV LAAVKSVGEP KYFTTSDRRK GQRCEVRLYD
210 220 230 240 250
ETESSFAMTC WDNESILLAQ SWMPRETVIF ASDVRINFDK FRNCMTATVI
260 270 280 290 300
SKTIITTNPD IPEANILLNF IRENKETNVL DDEIDSYFKE SINLSTIVDV
310 320 330 340 350
YTVEQLKGKA LKNEGKADPS YGILYAYIST LNIDDETTKV VRNRCSSCGY
360 370 380 390 400
IVNEASNMCT TCNKNSLDFK SVFLSFHVLI DLTDHTGTLH SCSLTGSVAE
410 420 430 440
ETLGCTFVLS HRARSGLKIS VLSCKLADPT EASRNLSGQK HV
Length:442
Mass (Da):49,313
Last modified:May 5, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3418C8EB3672EE8F
GO
Isoform 2 (identifier: Q8N635-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     406-406: T → TVHEFLAMTDEQKTALKWQFLLERSKIYLK

Show »
Length:471
Mass (Da):52,862
Checksum:i64FBA7364EF3F6AD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BU10H3BU10_HUMAN
Meiosis-specific with OB domain-con...
MEIOB MGC35212, hCG_1647025
264Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSU6H3BSU6_HUMAN
Meiosis-specific with OB domain-con...
MEIOB
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU18H3BU18_HUMAN
Meiosis-specific with OB domain-con...
MEIOB
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH29829 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAK61296 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06161918T → P. Corresponds to variant dbSNP:rs1742446Ensembl.1
Natural variantiVAR_08003464N → I in SPGF22. 1 PublicationCorresponds to variant dbSNP:rs1555472691EnsemblClinVar.1
Natural variantiVAR_05962475K → T. Corresponds to variant dbSNP:rs1657125Ensembl.1
Natural variantiVAR_043620261I → T. Corresponds to variant dbSNP:rs9806945Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047664406T → TVHEFLAMTDEQKTALKWQF LLERSKIYLK in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE006639 Genomic DNA Translation: AAK61296.1 Sequence problems.
AL031722, AL499628 Genomic DNA Translation: CAM26474.1
AL499628, AL031722 Genomic DNA Translation: CAM28376.1
AL132823 Genomic DNA No translation available.
BC029829 mRNA Translation: AAH29829.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10449.2 [Q8N635-1]
CCDS53983.1 [Q8N635-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001157032.1, NM_001163560.2 [Q8N635-2]
NP_689977.2, NM_152764.2 [Q8N635-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325962; ENSP00000314484; ENSG00000162039 [Q8N635-2]
ENST00000397344; ENSP00000380504; ENSG00000162039 [Q8N635-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
254528

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:254528

UCSC genome browser

More...
UCSCi
uc002cne.3, human [Q8N635-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE006639 Genomic DNA Translation: AAK61296.1 Sequence problems.
AL031722, AL499628 Genomic DNA Translation: CAM26474.1
AL499628, AL031722 Genomic DNA Translation: CAM28376.1
AL132823 Genomic DNA No translation available.
BC029829 mRNA Translation: AAH29829.1 Different initiation.
CCDSiCCDS10449.2 [Q8N635-1]
CCDS53983.1 [Q8N635-2]
RefSeqiNP_001157032.1, NM_001163560.2 [Q8N635-2]
NP_689977.2, NM_152764.2 [Q8N635-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi129038, 3 interactors
IntActiQ8N635, 1 interactor
STRINGi9606.ENSP00000390778

PTM databases

iPTMnetiQ8N635
PhosphoSitePlusiQ8N635

Genetic variation databases

BioMutaiMEIOB
DMDMi229462984

Proteomic databases

MassIVEiQ8N635
PeptideAtlasiQ8N635
PRIDEiQ8N635
ProteomicsDBi72128 [Q8N635-1]
7972

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
42506, 40 antibodies

The DNASU plasmid repository

More...
DNASUi
254528

Genome annotation databases

EnsembliENST00000325962; ENSP00000314484; ENSG00000162039 [Q8N635-2]
ENST00000397344; ENSP00000380504; ENSG00000162039 [Q8N635-1]
GeneIDi254528
KEGGihsa:254528
UCSCiuc002cne.3, human [Q8N635-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
254528
DisGeNETi254528

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MEIOB
HGNCiHGNC:28569, MEIOB
HPAiENSG00000162039, Tissue enriched (testis)
MalaCardsiMEIOB
MIMi617670, gene
617706, phenotype
neXtProtiNX_Q8N635
OpenTargetsiENSG00000162039
Orphaneti399805, Male infertility with azoospermia or oligozoospermia due to single gene mutation
PharmGKBiPA145149601
VEuPathDBiHostDB:ENSG00000162039.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0851, Eukaryota
GeneTreeiENSGT00390000001723
HOGENOMiCLU_042457_2_0_1
InParanoidiQ8N635
OMAiWGQRACV
OrthoDBi615895at2759
PhylomeDBiQ8N635
TreeFamiTF323670

Enzyme and pathway databases

PathwayCommonsiQ8N635

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
254528, 2 hits in 993 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MEIOB, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
254528
PharosiQ8N635, Tdark

Protein Ontology

More...
PROi
PR:Q8N635
RNActiQ8N635, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162039, Expressed in right testis and 106 other tissues
ExpressionAtlasiQ8N635, baseline and differential
GenevisibleiQ8N635, HS

Family and domain databases

InterProiView protein in InterPro
IPR012340, NA-bd_OB-fold
SUPFAMiSSF50249, SSF50249, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMEIOB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N635
Secondary accession number(s): B1AK39, C9J0S1, Q96RY0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 5, 2009
Last modified: June 2, 2021
This is version 129 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again