Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (13 Feb 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Male-specific lethal 3 homolog

Gene

MSL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in chromatin remodeling and transcriptional regulation. May have a role in X inactivation. Component of the MSL complex which is responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure. Specifically recognizes histone H4 monomethylated at 'Lys-20' (H4K20Me1) in a DNA-dependent manner and is proposed to be involved in chromosomal targeting of the MSL complex.6 Publications

Miscellaneous

MSL3L1 gene undergoes X inactivation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • methylated histone binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214847 HATs acetylate histones

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Male-specific lethal 3 homolog
Alternative name(s):
Male-specific lethal-3 homolog 1
Male-specific lethal-3 protein-like 1
Short name:
MSL3-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MSL3
Synonyms:MSL3L1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000005302.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7370 MSL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300609 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N5Y2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi31Y → A: Diminishes interaction with histone H4 monomethylated at 'Lys-20'(H4K20Me1). 1 Publication1
Mutagenesisi55H → A: Diminishes DNA-binding; when associated with A-65. 1 Publication1
Mutagenesisi56F → A: Abolishes interaction with histone H4 monomethylated at 'Lys-20'(H4K20Me1). 1
Mutagenesisi59W → G: Diminishes DNA-binding. 1 Publication1
Mutagenesisi65R → A: Diminishes DNA-binding; when associated with A-55. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000005302

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164723161

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MSL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
32171482

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000802471 – 521Male-specific lethal 3 homologAdd BLAST521

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei309PhosphoserineBy similarity1
Modified residuei311PhosphoserineCombined sources1
Modified residuei367PhosphoserineCombined sources1
Modified residuei400PhosphoserineCombined sources1
Modified residuei405PhosphothreonineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei411PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N5Y2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N5Y2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N5Y2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N5Y2

PeptideAtlas

More...
PeptideAtlasi
Q8N5Y2

PRoteomics IDEntifications database

More...
PRIDEi
Q8N5Y2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
72108
72109 [Q8N5Y2-2]
72110 [Q8N5Y2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N5Y2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N5Y2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in many tissues including liver, pancreas, heart, lung, kidney, skeletal muscle, brain, and placenta, with highest expression in skeletal muscle and heart.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000005302 Expressed in 220 organ(s), highest expression level in small intestine Peyer's patch

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N5Y2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N5Y2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034535
HPA034536

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component the MSL histone acetyltransferase complex at least composed of the MOF/KAT8, MSL1/hampin, MSL2 and MSL3. Interacts (via the MRG domain) with MSL1.4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116143, 18 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-815 MSL histone acetyltransferase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8N5Y2

Database of interacting proteins

More...
DIPi
DIP-56857N

Protein interaction database and analysis system

More...
IntActi
Q8N5Y2, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312244

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1521
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y0NX-ray3.00A/B/C/D167-289[»]
A/B/C/D442-518[»]
3OA6X-ray2.35A/B1-101[»]
3OB9X-ray2.50A/B/C/D/E2-93[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8N5Y2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N5Y2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8N5Y2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 90ChromoAdd BLAST59
Domaini168 – 517MRGPROSITE-ProRule annotationAdd BLAST350

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni290 – 440Required for the histone acetyltransferase activity of the MSL complexAdd BLAST151

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3001 Eukaryota
ENOG410XR9F LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111072

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293161

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052511

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N5Y2

KEGG Orthology (KO)

More...
KOi
K18403

Identification of Orthologs from Complete Genome Data

More...
OMAi
SYPPGDQ

Database of Orthologous Groups

More...
OrthoDBi
1624495at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N5Y2

TreeFam database of animal gene trees

More...
TreeFami
TF323400

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00024 CHROMO, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.274.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR008676 MRG
IPR038217 MRG_C_sf
IPR026541 MRG_dom
IPR037921 MSL3
IPR025995 Tudor-knot

The PANTHER Classification System

More...
PANTHERi
PTHR10880 PTHR10880, 1 hit
PTHR10880:SF26 PTHR10880:SF26, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05712 MRG, 1 hit
PF11717 Tudor-knot, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00298 CHROMO, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54160 SSF54160, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51640 MRG, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 24 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N5Y2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSASEGMKFK FHSGEKVLCF EPDPTKARVL YDAKIVDVIV GKDEKGRKIP
60 70 80 90 100
EYLIHFNGWN RSWDRWAAED HVLRDTDENR RLQRKLARKA VARLRSTGRK
110 120 130 140 150
KKRCRLPGVD SVLKGLPTEE KDENDENSLS SSSDCSENKD EEISEESDIE
160 170 180 190 200
EKTEVKEEPE LQTRREMEER TITIEIPEVL KKQLEDDCYY INRRKRLVKL
210 220 230 240 250
PCQTNIITIL ESYVKHFAIN AAFSANERPR HHHVMPHANM NVHYIPAEKN
260 270 280 290 300
VDLCKEMVDG LRITFDYTLP LVLLYPYEQA QYKKVTSSKF FLPIKESATS
310 320 330 340 350
TNRSQEELSP SPPLLNPSTP QSTESQPTTG EPATPKRRKA EPEALQSLRR
360 370 380 390 400
STRHSANCDR LSESSASPQP KRRQQDTSAS MPKLFLHLEK KTPVHSRSSS
410 420 430 440 450
PIPLTPSKEG SAVFAGFEGR RTNEINEVLS WKLVPDNYPP GDQPPPPSYI
460 470 480 490 500
YGAQHLLRLF VKLPEILGKM SFSEKNLKAL LKHFDLFLRF LAEYHDDFFP
510 520
ESAYVAACEA HYSTKNPRAI Y
Length:521
Mass (Da):59,824
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6DFFB9E183D0CFB9
GO
Isoform 2 (identifier: Q8N5Y2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: Missing.
     60-61: NR → MP

Note: Based on similarity to mouse ortholog. No experimental confirmation available.Curated
Show »
Length:462
Mass (Da):53,043
Checksum:i88D09081DA2C7F1A
GO
Isoform 3 (identifier: Q8N5Y2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAK → MSPSVRPGAGWAPVGRPGRPIQ

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):58,249
Checksum:i50F8B10061D5E89E
GO
Isoform 4 (identifier: Q8N5Y2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-166: Missing.

Note: No experimental confirmation available.
Show »
Length:355
Mass (Da):40,577
Checksum:i86211AD697FA2C88
GO
Isoform 5 (identifier: Q8N5Y2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     391-416: KTPVHSRSSSPIPLTPSKEGSAVFAG → SRFILGCPRPGRASVYFVFSQCQAWC
     417-521: Missing.

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):47,950
Checksum:i97B2DC9F80BE09BE
GO
Isoform 6 (identifier: Q8N5Y2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MSASEG → MKMMKT
     7-155: Missing.

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):42,725
Checksum:iFD52D6BBAFA528D9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 24 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NLU8A6NLU8_HUMAN
Male-specific lethal 3 homolog
MSL3
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JKR8C9JKR8_HUMAN
Male-specific lethal 3 homolog
MSL3
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BYE4H7BYE4_HUMAN
Male-specific lethal 3 homolog
MSL3
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC61F8WC61_HUMAN
Male-specific lethal 3 homolog
MSL3
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT59A0A3B3IT59_HUMAN
Male-specific lethal 3 homolog
MSL3
520Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITF3A0A3B3ITF3_HUMAN
Male-specific lethal 3 homolog
MSL3
431Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITL5A0A3B3ITL5_HUMAN
Male-specific lethal 3 homolog
MSL3
488Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITH5A0A3B3ITH5_HUMAN
Male-specific lethal 3 homolog
MSL3
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IU53A0A3B3IU53_HUMAN
Male-specific lethal 3 homolog
MSL3
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IRI6A0A3B3IRI6_HUMAN
Male-specific lethal 3 homolog
MSL3
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti37D → V in AAD38499 (PubMed:10395802).Curated1
Sequence conflicti346Q → R in AK025642 (PubMed:14702039).Curated1
Sequence conflicti391K → E in AK025642 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0690612S → T1 PublicationCorresponds to variant dbSNP:rs150938844Ensembl.1
Natural variantiVAR_048732199K → Q. Corresponds to variant dbSNP:rs1051595Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456521 – 166Missing in isoform 4. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_0076361 – 59Missing in isoform 2. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_0433421 – 34MSASE…LYDAK → MSPSVRPGAGWAPVGRPGRP IQ in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0553761 – 6MSASEG → MKMMKT in isoform 6. 1 Publication6
Alternative sequenceiVSP_0553777 – 155Missing in isoform 6. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_00763760 – 61NR → MP in isoform 2. 1 Publication2
Alternative sequenceiVSP_045653391 – 416KTPVH…AVFAG → SRFILGCPRPGRASVYFVFS QCQAWC in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_045654417 – 521Missing in isoform 5. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF117065 mRNA Translation: AAD38499.1
AK025642 mRNA No translation available.
AK289780 mRNA Translation: BAF82469.1
AK294255 mRNA Translation: BAH11713.1
AK300814 mRNA Translation: BAG62470.1
AC004554 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98799.1
CH471074 Genomic DNA Translation: EAW98801.1
BC031210 mRNA Translation: AAH31210.1
AL050178 mRNA Translation: CAB43308.1
AL713667 mRNA Translation: CAD28473.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14147.1 [Q8N5Y2-1]
CCDS14148.1 [Q8N5Y2-5]
CCDS14149.1 [Q8N5Y2-4]
CCDS55369.1 [Q8N5Y2-3]
CCDS65213.1 [Q8N5Y2-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08795

NCBI Reference Sequences

More...
RefSeqi
NP_001180199.1, NM_001193270.2 [Q8N5Y2-3]
NP_001269103.1, NM_001282174.1 [Q8N5Y2-6]
NP_006791.2, NM_006800.3 [Q8N5Y2-4]
NP_523352.1, NM_078628.1 [Q8N5Y2-5]
NP_523353.2, NM_078629.3 [Q8N5Y2-1]
XP_005274497.1, XM_005274440.2 [Q8N5Y2-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655288

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312196; ENSP00000312244; ENSG00000005302 [Q8N5Y2-1]
ENST00000337339; ENSP00000338078; ENSG00000005302 [Q8N5Y2-5]
ENST00000361672; ENSP00000354562; ENSG00000005302 [Q8N5Y2-6]
ENST00000398527; ENSP00000381538; ENSG00000005302 [Q8N5Y2-3]
ENST00000482871; ENSP00000498064; ENSG00000005302 [Q8N5Y2-4]
ENST00000648013; ENSP00000497518; ENSG00000005302 [Q8N5Y2-4]
ENST00000649078; ENSP00000498017; ENSG00000005302 [Q8N5Y2-4]
ENST00000649271; ENSP00000496967; ENSG00000005302 [Q8N5Y2-4]
ENST00000649602; ENSP00000498168; ENSG00000005302 [Q8N5Y2-4]
ENST00000649649; ENSP00000497137; ENSG00000005302 [Q8N5Y2-6]
ENST00000649685; ENSP00000497496; ENSG00000005302 [Q8N5Y2-6]
ENST00000650215; ENSP00000496944; ENSG00000005302 [Q8N5Y2-6]
ENST00000650628; ENSP00000496838; ENSG00000005302 [Q8N5Y2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10943

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10943

UCSC genome browser

More...
UCSCi
uc004cuv.2 human [Q8N5Y2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117065 mRNA Translation: AAD38499.1
AK025642 mRNA No translation available.
AK289780 mRNA Translation: BAF82469.1
AK294255 mRNA Translation: BAH11713.1
AK300814 mRNA Translation: BAG62470.1
AC004554 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98799.1
CH471074 Genomic DNA Translation: EAW98801.1
BC031210 mRNA Translation: AAH31210.1
AL050178 mRNA Translation: CAB43308.1
AL713667 mRNA Translation: CAD28473.1
CCDSiCCDS14147.1 [Q8N5Y2-1]
CCDS14148.1 [Q8N5Y2-5]
CCDS14149.1 [Q8N5Y2-4]
CCDS55369.1 [Q8N5Y2-3]
CCDS65213.1 [Q8N5Y2-6]
PIRiT08795
RefSeqiNP_001180199.1, NM_001193270.2 [Q8N5Y2-3]
NP_001269103.1, NM_001282174.1 [Q8N5Y2-6]
NP_006791.2, NM_006800.3 [Q8N5Y2-4]
NP_523352.1, NM_078628.1 [Q8N5Y2-5]
NP_523353.2, NM_078629.3 [Q8N5Y2-1]
XP_005274497.1, XM_005274440.2 [Q8N5Y2-4]
UniGeneiHs.655288

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y0NX-ray3.00A/B/C/D167-289[»]
A/B/C/D442-518[»]
3OA6X-ray2.35A/B1-101[»]
3OB9X-ray2.50A/B/C/D/E2-93[»]
ProteinModelPortaliQ8N5Y2
SMRiQ8N5Y2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116143, 18 interactors
ComplexPortaliCPX-815 MSL histone acetyltransferase complex
CORUMiQ8N5Y2
DIPiDIP-56857N
IntActiQ8N5Y2, 6 interactors
STRINGi9606.ENSP00000312244

PTM databases

iPTMnetiQ8N5Y2
PhosphoSitePlusiQ8N5Y2

Polymorphism and mutation databases

BioMutaiMSL3
DMDMi32171482

Proteomic databases

EPDiQ8N5Y2
jPOSTiQ8N5Y2
MaxQBiQ8N5Y2
PaxDbiQ8N5Y2
PeptideAtlasiQ8N5Y2
PRIDEiQ8N5Y2
ProteomicsDBi72108
72109 [Q8N5Y2-2]
72110 [Q8N5Y2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10943
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312196; ENSP00000312244; ENSG00000005302 [Q8N5Y2-1]
ENST00000337339; ENSP00000338078; ENSG00000005302 [Q8N5Y2-5]
ENST00000361672; ENSP00000354562; ENSG00000005302 [Q8N5Y2-6]
ENST00000398527; ENSP00000381538; ENSG00000005302 [Q8N5Y2-3]
ENST00000482871; ENSP00000498064; ENSG00000005302 [Q8N5Y2-4]
ENST00000648013; ENSP00000497518; ENSG00000005302 [Q8N5Y2-4]
ENST00000649078; ENSP00000498017; ENSG00000005302 [Q8N5Y2-4]
ENST00000649271; ENSP00000496967; ENSG00000005302 [Q8N5Y2-4]
ENST00000649602; ENSP00000498168; ENSG00000005302 [Q8N5Y2-4]
ENST00000649649; ENSP00000497137; ENSG00000005302 [Q8N5Y2-6]
ENST00000649685; ENSP00000497496; ENSG00000005302 [Q8N5Y2-6]
ENST00000650215; ENSP00000496944; ENSG00000005302 [Q8N5Y2-6]
ENST00000650628; ENSP00000496838; ENSG00000005302 [Q8N5Y2-4]
GeneIDi10943
KEGGihsa:10943
UCSCiuc004cuv.2 human [Q8N5Y2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10943
EuPathDBiHostDB:ENSG00000005302.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MSL3
HGNCiHGNC:7370 MSL3
HPAiHPA034535
HPA034536
MIMi300609 gene
neXtProtiNX_Q8N5Y2
OpenTargetsiENSG00000005302
PharmGKBiPA164723161

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3001 Eukaryota
ENOG410XR9F LUCA
GeneTreeiENSGT00730000111072
HOGENOMiHOG000293161
HOVERGENiHBG052511
InParanoidiQ8N5Y2
KOiK18403
OMAiSYPPGDQ
OrthoDBi1624495at2759
PhylomeDBiQ8N5Y2
TreeFamiTF323400

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MSL3 human
EvolutionaryTraceiQ8N5Y2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10943

Protein Ontology

More...
PROi
PR:Q8N5Y2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000005302 Expressed in 220 organ(s), highest expression level in small intestine Peyer's patch
ExpressionAtlasiQ8N5Y2 baseline and differential
GenevisibleiQ8N5Y2 HS

Family and domain databases

CDDicd00024 CHROMO, 1 hit
Gene3Di1.10.274.30, 2 hits
InterProiView protein in InterPro
IPR016197 Chromo-like_dom_sf
IPR000953 Chromo/chromo_shadow_dom
IPR008676 MRG
IPR038217 MRG_C_sf
IPR026541 MRG_dom
IPR037921 MSL3
IPR025995 Tudor-knot
PANTHERiPTHR10880 PTHR10880, 1 hit
PTHR10880:SF26 PTHR10880:SF26, 1 hit
PfamiView protein in Pfam
PF05712 MRG, 1 hit
PF11717 Tudor-knot, 1 hit
SMARTiView protein in SMART
SM00298 CHROMO, 1 hit
SUPFAMiSSF54160 SSF54160, 1 hit
PROSITEiView protein in PROSITE
PS51640 MRG, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMS3L1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N5Y2
Secondary accession number(s): A6NCU2
, A6NHW8, A8K165, B4DUV8, B7Z227, Q9UG70, Q9Y5Z8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2003
Last sequence update: October 1, 2002
Last modified: February 13, 2019
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again