Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q8N5N7 (RM50_HUMAN)

Entry version 143 (07 Apr 2021)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Add a publicationFeedback
Protein

39S ribosomal protein L50, mitochondrial

Gene

MRPL50

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8N5N7

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5368286, Mitochondrial translation initiation
R-HSA-5389840, Mitochondrial translation elongation
R-HSA-5419276, Mitochondrial translation termination

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8N5N7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
39S ribosomal protein L50, mitochondrial
Short name:
L50mt
Short name:
MRP-L50
Alternative name(s):
Mitochondrial large ribosomal subunit protein mL501 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MRPL50
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16654, MRPL50

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611854, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N5N7

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000136897.7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000136897

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30983

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8N5N7, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MRPL50

Domain mapping of disease mutations (DMDM)

More...DMDMi		118573685

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002616591 – 15839S ribosomal protein L50, mitochondrialAdd BLAST158

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8N5N7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N5N7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8N5N7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N5N7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8N5N7

PeptideAtlas

More...PeptideAtlasi		Q8N5N7

PRoteomics IDEntifications database

More...PRIDEi		Q8N5N7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		6492
72078 [Q8N5N7-1]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q8N5N7-1 [Q8N5N7-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N5N7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N5N7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000136897, Expressed in testis and 219 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N5N7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000136897, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:25278503, PubMed:25838379, PubMed:28892042). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins.

3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120021, 188 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-5226, 39S mitochondrial large ribosomal subunit

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8N5N7

Protein interaction database and analysis system

More...IntActi		Q8N5N7, 114 interactors

Molecular INTeraction database

More...MINTi		Q8N5N7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000363999

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8N5N7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8N5N7

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mitochondrion-specific ribosomal protein mL50 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S27V, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000004279

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_137129_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N5N7

Identification of Orthologs from Complete Genome Data

More...OMAi		NLKITWN

Database of Orthologous Groups

More...OrthoDBi		1586864at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N5N7

TreeFam database of animal gene trees

More...TreeFami		TF105895

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018305, Ribosomal_L50_mt

The PANTHER Classification System

More...PANTHERi		PTHR31542, PTHR31542, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF10501, Ribosomal_L50, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N5N7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARSVSGIT RRVFMWTVSG TPCREFWSRF RKEKEPVVVE TVEEKKEPIL 
        60         70         80         90        100
VCPPLRSRAY TPPEDLQSRL ESYVKEVFGS SLPSNWQDIS LEDSRLKFNL 
       110        120        130        140        150
LAHLADDLGH VVPNSRLHQM CRVRDVLDFY NVPIQDRSKF DELSASNLPP 

NLKITWSY
Length:158
Mass (Da):18,325
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF8FD54809C08EF0E
GO
Isoform 2 (identifier: Q8N5N7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-158: VRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY → GYSFEEGKIQLGI

Show »
Length:135
Mass (Da):15,524
Checksum:iD242D9E74F11E062
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029474127L → F1 PublicationCorresponds to variant dbSNP:rs8131Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056091123 – 158VRDVL…ITWSY → GYSFEEGKIQLGI in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK000500 mRNA Translation: BAA91207.1
AK025643 mRNA Translation: BAB15200.1
AK295521 mRNA Translation: BAH12094.1
AL353621 Genomic DNA No translation available.
BC032008 mRNA Translation: AAH32008.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS6753.1 [Q8N5N7-1]

NCBI Reference Sequences

More...RefSeqi		NP_061924.1, NM_019051.2 [Q8N5N7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000374865; ENSP00000363999; ENSG00000136897 [Q8N5N7-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		54534

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:54534

UCSC genome browser

More...UCSCi		uc004bbe.3, human [Q8N5N7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000500 mRNA Translation: BAA91207.1
AK025643 mRNA Translation: BAB15200.1
AK295521 mRNA Translation: BAH12094.1
AL353621 Genomic DNA No translation available.
BC032008 mRNA Translation: AAH32008.1
CCDSiCCDS6753.1 [Q8N5N7-1]
RefSeqiNP_061924.1, NM_019051.2 [Q8N5N7-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40h1-158[»]
3J9Melectron microscopy3.50h1-158[»]
5OOLelectron microscopy3.06h1-158[»]
5OOMelectron microscopy3.03h1-158[»]
6I9Relectron microscopy3.90h1-158[»]
6NU2electron microscopy3.90h56-158[»]
6NU3electron microscopy4.40h1-158[»]
6VLZelectron microscopy2.97h1-158[»]
6VMIelectron microscopy2.96h1-158[»]
6ZM5electron microscopy2.89h1-158[»]
6ZM6electron microscopy2.59h1-158[»]
6ZS9electron microscopy4.00h1-158[»]
6ZSAelectron microscopy4.00h1-158[»]
6ZSBelectron microscopy4.50h1-158[»]
6ZSCelectron microscopy3.50h1-158[»]
6ZSDelectron microscopy3.70h1-158[»]
6ZSEelectron microscopy5.00h1-158[»]
6ZSGelectron microscopy4.00h1-158[»]
7A5Felectron microscopy4.40h31-158[»]
7A5Gelectron microscopy4.33h31-158[»]
7A5Helectron microscopy3.30h1-158[»]
7A5Ielectron microscopy3.70h31-158[»]
7A5Jelectron microscopy3.10h1-158[»]
7A5Kelectron microscopy3.70h31-158[»]
SMRiQ8N5N7
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi120021, 188 interactors
ComplexPortaliCPX-5226, 39S mitochondrial large ribosomal subunit
CORUMiQ8N5N7
IntActiQ8N5N7, 114 interactors
MINTiQ8N5N7
STRINGi9606.ENSP00000363999

PTM databases

iPTMnetiQ8N5N7
PhosphoSitePlusiQ8N5N7

Genetic variation databases

BioMutaiMRPL50
DMDMi118573685

Proteomic databases

EPDiQ8N5N7
jPOSTiQ8N5N7
MassIVEiQ8N5N7
MaxQBiQ8N5N7
PaxDbiQ8N5N7
PeptideAtlasiQ8N5N7
PRIDEiQ8N5N7
ProteomicsDBi6492
72078 [Q8N5N7-1]
TopDownProteomicsiQ8N5N7-1 [Q8N5N7-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		14646, 136 antibodies

The DNASU plasmid repository

More...DNASUi		54534

Genome annotation databases

EnsembliENST00000374865; ENSP00000363999; ENSG00000136897 [Q8N5N7-1]
GeneIDi54534
KEGGihsa:54534
UCSCiuc004bbe.3, human [Q8N5N7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		54534

GeneCards: human genes, protein and diseases

More...GeneCardsi		MRPL50
HGNCiHGNC:16654, MRPL50
HPAiENSG00000136897, Low tissue specificity
MIMi611854, gene
neXtProtiNX_Q8N5N7
OpenTargetsiENSG00000136897
PharmGKBiPA30983
VEuPathDBiHostDB:ENSG00000136897.7

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S27V, Eukaryota
GeneTreeiENSGT00390000004279
HOGENOMiCLU_137129_0_0_1
InParanoidiQ8N5N7
OMAiNLKITWN
OrthoDBi1586864at2759
PhylomeDBiQ8N5N7
TreeFamiTF105895

Enzyme and pathway databases

PathwayCommonsiQ8N5N7
ReactomeiR-HSA-5368286, Mitochondrial translation initiation
R-HSA-5389840, Mitochondrial translation elongation
R-HSA-5419276, Mitochondrial translation termination
SIGNORiQ8N5N7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		54534, 259 hits in 996 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MRPL50, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		54534
PharosiQ8N5N7, Tdark

Protein Ontology

More...PROi		PR:Q8N5N7
RNActiQ8N5N7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000136897, Expressed in testis and 219 other tissues
GenevisibleiQ8N5N7, HS

Family and domain databases

InterProiView protein in InterPro
IPR018305, Ribosomal_L50_mt
PANTHERiPTHR31542, PTHR31542, 1 hit
PfamiView protein in Pfam
PF10501, Ribosomal_L50, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRM50_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N5N7
Secondary accession number(s): B7Z358, Q5T7E0, Q9NX15
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: April 7, 2021
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Ribosomal proteins
    Ribosomal proteins families and list of entries
  2. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again