Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (10 Feb 2021)
Sequence version 2 (02 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Ubiquitin carboxyl-terminal hydrolase MINDY-1

Gene

MINDY1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).1 Publication EC:3.4.19.12

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei137Nucleophile1 Publication1
Active sitei319Proton acceptor1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei412Ubiquitin-binding1 Publication1
Sitei415 – 416Ubiquitin-binding1 Publication2
Sitei419Ubiquitin-binding1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processUbl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N5J2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin carboxyl-terminal hydrolase MINDY-11 Publication (EC:3.4.19.121 Publication)
Alternative name(s):
Deubiquitinating enzyme MINDY-11 Publication
Protein FAM63A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MINDY1Imported
Synonyms:FAM63A, KIAA1390
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25648, MINDY1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618407, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N5J2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000143409.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi131Q → A or E: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi137C → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi209D → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi210V → A: Greatly impairs ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi240W → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi258Y → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi263E → A: Greatly impairs ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi263E → R: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi315F → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi319H → A: Abolishes ubiquitin hydrolase activity. 1 Publication1
Mutagenesisi396A → G: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi408L → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi411T → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi412D → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi413L → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi414E → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi415 – 416LA → AG: Decreased association with 'Lys-48'-linked conjugated ubiquitin. 1 Publication2
Mutagenesisi415L → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi416A → G or D: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi416A → S: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi418Q → A or K: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi419L → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi420Q → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi421Q → E or R: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi422E → A: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423E → A: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423E → EA, EAAA, EAAAAAA or EAAAAAAA: Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi423Missing : Loss of binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi424Y → A, D or E: Decreased binding to 'Lys-48' tetraubiquitin chains. 1 Publication1
Mutagenesisi424Y → F or W: No effect on binding to 'Lys-48' tetraubiquitin chains. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
55793

Open Targets

More...
OpenTargetsi
ENSG00000143409

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671872

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N5J2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MINDY1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033379

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003440371 – 469Ubiquitin carboxyl-terminal hydrolase MINDY-1Add BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei103PhosphoserineCombined sources1
Modified residuei441PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N5J2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N5J2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N5J2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N5J2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N5J2

PeptideAtlas

More...
PeptideAtlasi
Q8N5J2

PRoteomics IDEntifications database

More...
PRIDEi
Q8N5J2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72065 [Q8N5J2-1]
72066 [Q8N5J2-2]
72067 [Q8N5J2-3]
72068 [Q8N5J2-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8N5J2-2 [Q8N5J2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N5J2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N5J2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143409, Expressed in body of pancreas and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N5J2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N5J2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000143409, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120906, 25 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N5J2, 15 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354669

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N5J2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1469
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N5J2

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni388 – 426Ubiquitin-binding domain (UBD)1 PublicationAdd BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi386 – 431Gln-richAdd BLAST46

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2427, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016607

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_022566_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N5J2

Identification of Orthologs from Complete Genome Data

More...
OMAi
NHEVPLG

Database of Orthologous Groups

More...
OrthoDBi
1601180at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N5J2

TreeFam database of animal gene trees

More...
TreeFami
TF314589

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007518, MINDY
IPR033979, MINDY_domain

The PANTHER Classification System

More...
PANTHERi
PTHR18063, PTHR18063, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04424, MINDY_DUB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N5J2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEYHQPEDPA PGKAGTAEAV IPENHEVLAG PDEHPQDTDA RDADGEARER
60 70 80 90 100
EPADQALLPS QCGDNLESPL PEASSAPPGP TLGTLPEVET IRACSMPQEL
110 120 130 140 150
PQSPRTRQPE PDFYCVKWIP WKGEQTPIIT QSTNGPCPLL AIMNILFLQW
160 170 180 190 200
KVKLPPQKEV ITSDELMAHL GNCLLSIKPQ EKSEGLQLNF QQNVDDAMTV
210 220 230 240 250
LPKLATGLDV NVRFTGVSDF EYTPECSVFD LLGIPLYHGW LVDPQSPEAV
260 270 280 290 300
RAVGKLSYNQ LVERIITCKH SSDTNLVTEG LIAEQFLETT AAQLTYHGLC
310 320 330 340 350
ELTAAAKEGE LSVFFRNNHF STMTKHKSHL YLLVTDQGFL QEEQVVWESL
360 370 380 390 400
HNVDGDSCFC DSDFHLSHSL GKGPGAEGGS GSPETQLQVD QDYLIALSLQ
410 420 430 440 450
QQQPRGPLGL TDLELAQQLQ QEEYQQQQAA QPVRMRTRVL SLQGRGATSG
460
RPAGERRQRP KHESDCILL
Length:469
Mass (Da):51,778
Last modified:November 2, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFEB658BAF8A878C6
GO
Isoform 2 (identifier: Q8N5J2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-142: Missing.

Show »
Length:327
Mass (Da):36,458
Checksum:iA0B153B6B2217B7A
GO
Isoform 3 (identifier: Q8N5J2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLLGPPPFNESTKPSPSPCHSFASQAWLRQVPEVSKHLQCPSAKSLLTM

Show »
Length:517
Mass (Da):56,991
Checksum:i6BBA4F7A62BF16FD
GO
Isoform 4 (identifier: Q8N5J2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:374
Mass (Da):41,833
Checksum:i49C3DA92F5491B1A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YJH5H0YJH5_HUMAN
Ubiquitin carboxyl-terminal hydrola...
MINDY1
142Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92628 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti287L → P in BAA92104 (PubMed:14702039).Curated1
Sequence conflicti367S → R in BAA92104 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q8N5J2-3)
Sequence conflicti44K → E in BAG63364 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044541385T → K4 PublicationsCorresponds to variant dbSNP:rs2925741Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0347151 – 142Missing in isoform 2. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_0370761 – 95Missing in isoform 4. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0370771M → MLLGPPPFNESTKPSPSPCH SFASQAWLRQVPEVSKHLQC PSAKSLLTM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB037811 mRNA Translation: BAA92628.1 Different initiation.
AK002142 mRNA Translation: BAA92104.1
AK125493 mRNA Translation: BAG54206.1
AK125959 mRNA Translation: BAG54270.1
AK301946 mRNA Translation: BAG63364.1
AK303962 mRNA Translation: BAG64886.1
AL590133 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53491.1
CH471121 Genomic DNA Translation: EAW53492.1
CH471121 Genomic DNA Translation: EAW53493.1
CH471121 Genomic DNA Translation: EAW53495.1
BC032321 mRNA Translation: AAH32321.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30854.1 [Q8N5J2-2]
CCDS53361.1 [Q8N5J2-3]
CCDS55635.1 [Q8N5J2-4]
CCDS976.1 [Q8N5J2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001035307.1, NM_001040217.2 [Q8N5J2-2]
NP_001156730.1, NM_001163258.1 [Q8N5J2-3]
NP_001156731.1, NM_001163259.1 [Q8N5J2-4]
NP_001156732.1, NM_001163260.1 [Q8N5J2-2]
NP_001306927.1, NM_001319998.1 [Q8N5J2-1]
NP_060849.2, NM_018379.4 [Q8N5J2-1]
XP_016857261.1, XM_017001772.1
XP_016857266.1, XM_017001777.1 [Q8N5J2-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312210; ENSP00000310923; ENSG00000143409 [Q8N5J2-2]
ENST00000361738; ENSP00000354669; ENSG00000143409 [Q8N5J2-3]
ENST00000361936; ENSP00000354814; ENSG00000143409 [Q8N5J2-1]
ENST00000493834; ENSP00000437174; ENSG00000143409 [Q8N5J2-4]
ENST00000622754; ENSP00000481304; ENSG00000143409 [Q8N5J2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55793

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55793

UCSC genome browser

More...
UCSCi
uc001ewd.4, human [Q8N5J2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037811 mRNA Translation: BAA92628.1 Different initiation.
AK002142 mRNA Translation: BAA92104.1
AK125493 mRNA Translation: BAG54206.1
AK125959 mRNA Translation: BAG54270.1
AK301946 mRNA Translation: BAG63364.1
AK303962 mRNA Translation: BAG64886.1
AL590133 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53491.1
CH471121 Genomic DNA Translation: EAW53492.1
CH471121 Genomic DNA Translation: EAW53493.1
CH471121 Genomic DNA Translation: EAW53495.1
BC032321 mRNA Translation: AAH32321.1
CCDSiCCDS30854.1 [Q8N5J2-2]
CCDS53361.1 [Q8N5J2-3]
CCDS55635.1 [Q8N5J2-4]
CCDS976.1 [Q8N5J2-1]
RefSeqiNP_001035307.1, NM_001040217.2 [Q8N5J2-2]
NP_001156730.1, NM_001163258.1 [Q8N5J2-3]
NP_001156731.1, NM_001163259.1 [Q8N5J2-4]
NP_001156732.1, NM_001163260.1 [Q8N5J2-2]
NP_001306927.1, NM_001319998.1 [Q8N5J2-1]
NP_060849.2, NM_018379.4 [Q8N5J2-1]
XP_016857261.1, XM_017001772.1
XP_016857266.1, XM_017001777.1 [Q8N5J2-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5JKNX-ray3.00A110-384[»]
5JQSX-ray2.65A110-384[»]
5MN9X-ray2.05C388-426[»]
SMRiQ8N5J2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi120906, 25 interactors
IntActiQ8N5J2, 15 interactors
STRINGi9606.ENSP00000354669

PTM databases

iPTMnetiQ8N5J2
PhosphoSitePlusiQ8N5J2

Genetic variation databases

BioMutaiMINDY1
DMDMi311033379

Proteomic databases

EPDiQ8N5J2
jPOSTiQ8N5J2
MassIVEiQ8N5J2
MaxQBiQ8N5J2
PaxDbiQ8N5J2
PeptideAtlasiQ8N5J2
PRIDEiQ8N5J2
ProteomicsDBi72065 [Q8N5J2-1]
72066 [Q8N5J2-2]
72067 [Q8N5J2-3]
72068 [Q8N5J2-4]
TopDownProteomicsiQ8N5J2-2 [Q8N5J2-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34043, 87 antibodies

The DNASU plasmid repository

More...
DNASUi
55793

Genome annotation databases

EnsembliENST00000312210; ENSP00000310923; ENSG00000143409 [Q8N5J2-2]
ENST00000361738; ENSP00000354669; ENSG00000143409 [Q8N5J2-3]
ENST00000361936; ENSP00000354814; ENSG00000143409 [Q8N5J2-1]
ENST00000493834; ENSP00000437174; ENSG00000143409 [Q8N5J2-4]
ENST00000622754; ENSP00000481304; ENSG00000143409 [Q8N5J2-1]
GeneIDi55793
KEGGihsa:55793
UCSCiuc001ewd.4, human [Q8N5J2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55793
DisGeNETi55793

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MINDY1
HGNCiHGNC:25648, MINDY1
HPAiENSG00000143409, Low tissue specificity
MIMi618407, gene
neXtProtiNX_Q8N5J2
OpenTargetsiENSG00000143409
PharmGKBiPA142671872
VEuPathDBiHostDB:ENSG00000143409.15

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2427, Eukaryota
GeneTreeiENSGT00390000016607
HOGENOMiCLU_022566_5_0_1
InParanoidiQ8N5J2
OMAiNHEVPLG
OrthoDBi1601180at2759
PhylomeDBiQ8N5J2
TreeFamiTF314589

Enzyme and pathway databases

PathwayCommonsiQ8N5J2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55793, 47 hits in 885 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM63A, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55793
PharosiQ8N5J2, Tbio

Protein Ontology

More...
PROi
PR:Q8N5J2
RNActiQ8N5J2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143409, Expressed in body of pancreas and 220 other tissues
ExpressionAtlasiQ8N5J2, baseline and differential
GenevisibleiQ8N5J2, HS

Family and domain databases

InterProiView protein in InterPro
IPR007518, MINDY
IPR033979, MINDY_domain
PANTHERiPTHR18063, PTHR18063, 1 hit
PfamiView protein in Pfam
PF04424, MINDY_DUB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMINY1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N5J2
Secondary accession number(s): B3KWP4
, B3KWV8, B4DXF2, B4E1S4, D3DV09, J3KP53, Q5SZF0, Q9NUL9, Q9P2F7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: November 2, 2010
Last modified: February 10, 2021
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again