Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (12 Aug 2020)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Potassium channel regulatory protein

Gene

KCNRG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N5I3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Potassium channel regulatory protein
Short name:
Potassium channel regulator
Alternative name(s):
Protein CLLD4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNRG
Synonyms:CLLD4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000198553.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18893, KCNRG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607947, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N5I3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
283518

Open Targets

More...
OpenTargetsi
ENSG00000198553

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134924183

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N5I3, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KCNRG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74729005

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002389451 – 272Potassium channel regulatory proteinAdd BLAST272

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N5I3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N5I3

PeptideAtlas

More...
PeptideAtlasi
Q8N5I3

PRoteomics IDEntifications database

More...
PRIDEi
Q8N5I3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
72060 [Q8N5I3-1]
72061 [Q8N5I3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N5I3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N5I3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous in normal tissues and expressed in some tumor tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198553, Expressed in right uterine tube and 112 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N5I3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000198553, Tissue enhanced (fallopian tube, ovary)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form homooligomers.

Interacts with KCNA1 (via cytoplasmic N-terminal domain) and KCNA4.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
129592, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N5I3, 10 interactors

Molecular INTeraction database

More...
MINTi
Q8N5I3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000324191

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N5I3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 106BTBAdd BLAST102

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2723, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161898

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_087954_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N5I3

Identification of Orthologs from Complete Genome Data

More...
OMAi
FRIFGSC

Database of Orthologous Groups

More...
OrthoDBi
1078520at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N5I3

TreeFam database of animal gene trees

More...
TreeFami
TF315332

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR003131, T1-type_BTB

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02214, BTB_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00225, BTB, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54695, SSF54695, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N5I3-1) [UniParc]FASTAAdd to basket
Also known as: B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSQELVTLN VGGKIFTTRF STIKQFPASR LARMLDGRDQ EFKMVGGQIF
60 70 80 90 100
VDRDGDLFSF ILDFLRTHQL LLPTEFSDYL RLQREALFYE LRSLVDLLNP
110 120 130 140 150
YLLQPRPALV EVHFLSRNTQ AFFRVFGSCS KTIEMLTGRI TVFTEQPSAP
160 170 180 190 200
TWNGNFFPPQ MTLLPLPPQR PSYHDLVFQC GSDSTTDNQT GVRYVSIKPD
210 220 230 240 250
NRKLANGTNV LGLLIDTLLK EGFHLVSTRT VSSEDKTECY SFERIKSPEV
260 270
LITNETPKPE TIIIPEQSQI KK
Length:272
Mass (Da):31,048
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5018F55980F0BBA5
GO
Isoform 2 (identifier: Q8N5I3-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     194-229: YVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTR → LVCNGVISAHHNLRLWGSSDSPASASRVAGITGMFL
     230-272: Missing.

Show »
Length:229
Mass (Da):25,857
Checksum:i9065D19F89DEFA58
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019018194 – 229YVSIK…LVSTR → LVCNGVISAHHNLRLWGSSD SPASASRVAGITGMFL in isoform 2. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_019021230 – 272Missing in isoform 2. 3 PublicationsAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY129653 mRNA Translation: AAN06090.1
AY129654 mRNA Translation: AAN06091.1
AY169387 mRNA Translation: AAO11777.1
AY169388 mRNA Translation: AAO11778.1
AY190921 mRNA Translation: AAO27464.1
AY190922 mRNA Translation: AAO27465.1
AL137060 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08849.1
CH471075 Genomic DNA Translation: EAX08850.1
BC020887 mRNA Translation: AAH20887.1
BC032343 mRNA Translation: AAH32343.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41889.1 [Q8N5I3-2]
CCDS9424.1 [Q8N5I3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_775876.1, NM_173605.1 [Q8N5I3-1]
NP_955751.1, NM_199464.2 [Q8N5I3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312942; ENSP00000324191; ENSG00000198553 [Q8N5I3-1]
ENST00000360473; ENSP00000353661; ENSG00000198553 [Q8N5I3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
283518

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:283518

UCSC genome browser

More...
UCSCi
uc001vdt.4, human [Q8N5I3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY129653 mRNA Translation: AAN06090.1
AY129654 mRNA Translation: AAN06091.1
AY169387 mRNA Translation: AAO11777.1
AY169388 mRNA Translation: AAO11778.1
AY190921 mRNA Translation: AAO27464.1
AY190922 mRNA Translation: AAO27465.1
AL137060 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08849.1
CH471075 Genomic DNA Translation: EAX08850.1
BC020887 mRNA Translation: AAH20887.1
BC032343 mRNA Translation: AAH32343.1
CCDSiCCDS41889.1 [Q8N5I3-2]
CCDS9424.1 [Q8N5I3-1]
RefSeqiNP_775876.1, NM_173605.1 [Q8N5I3-1]
NP_955751.1, NM_199464.2 [Q8N5I3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi129592, 8 interactors
IntActiQ8N5I3, 10 interactors
MINTiQ8N5I3
STRINGi9606.ENSP00000324191

PTM databases

iPTMnetiQ8N5I3
PhosphoSitePlusiQ8N5I3

Polymorphism and mutation databases

BioMutaiKCNRG
DMDMi74729005

Proteomic databases

jPOSTiQ8N5I3
PaxDbiQ8N5I3
PeptideAtlasiQ8N5I3
PRIDEiQ8N5I3
ProteomicsDBi72060 [Q8N5I3-1]
72061 [Q8N5I3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
637, 135 antibodies

The DNASU plasmid repository

More...
DNASUi
10206
283518

Genome annotation databases

EnsembliENST00000312942; ENSP00000324191; ENSG00000198553 [Q8N5I3-1]
ENST00000360473; ENSP00000353661; ENSG00000198553 [Q8N5I3-2]
GeneIDi283518
KEGGihsa:283518
UCSCiuc001vdt.4, human [Q8N5I3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
283518
DisGeNETi283518
EuPathDBiHostDB:ENSG00000198553.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KCNRG
HGNCiHGNC:18893, KCNRG
HPAiENSG00000198553, Tissue enhanced (fallopian tube, ovary)
MIMi607947, gene
neXtProtiNX_Q8N5I3
OpenTargetsiENSG00000198553
PharmGKBiPA134924183

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2723, Eukaryota
GeneTreeiENSGT00940000161898
HOGENOMiCLU_087954_0_0_1
InParanoidiQ8N5I3
OMAiFRIFGSC
OrthoDBi1078520at2759
PhylomeDBiQ8N5I3
TreeFamiTF315332

Enzyme and pathway databases

PathwayCommonsiQ8N5I3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
283518, 15 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KCNRG, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KCNRG

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
283518
PharosiQ8N5I3, Tbio

Protein Ontology

More...
PROi
PR:Q8N5I3
RNActiQ8N5I3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198553, Expressed in right uterine tube and 112 other tissues
GenevisibleiQ8N5I3, HS

Family and domain databases

InterProiView protein in InterPro
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
IPR003131, T1-type_BTB
PfamiView protein in Pfam
PF02214, BTB_2, 1 hit
SMARTiView protein in SMART
SM00225, BTB, 1 hit
SUPFAMiSSF54695, SSF54695, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNRG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N5I3
Secondary accession number(s): A2A2X9
, Q0P6D0, Q8IU75, Q8N3Q9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: October 1, 2002
Last modified: August 12, 2020
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again