Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8N4V1 (MMGT1_HUMAN)

Entry version 134 (16 Oct 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Membrane magnesium transporter 1

Gene

MMGT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates Mg2+ transport.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport
LigandMagnesium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5223345 Miscellaneous transport and binding events

Protein family/group databases

Transport Classification Database

More...TCDBi		3.A.27.1.1 the c-terminal tail-anchored membrane protein biogenesis/ insertion complex-2 (tamp-b2) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Membrane magnesium transporter 1
Alternative name(s):
ER membrane protein complex subunit 5
Transmembrane protein 32
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MMGT1
Synonyms:EMC5, TMEM32
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28100 MMGT1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N4V1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 4CytoplasmicCurated4
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei5 – 25HelicalSequence analysisAdd BLAST21
Topological domaini26 – 44LumenalCuratedAdd BLAST19
Transmembranei45 – 65HelicalSequence analysisAdd BLAST21
Topological domaini66 – 131CytoplasmicCuratedAdd BLAST66

Keywords - Cellular componenti

Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000169446

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA164723074

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8N4V1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MMGT1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74751006

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002864351 – 131Membrane magnesium transporter 1Add BLAST131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei120PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8N4V1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N4V1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8N4V1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N4V1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8N4V1

PeptideAtlas

More...PeptideAtlasi		Q8N4V1

PRoteomics IDEntifications database

More...PRIDEi		Q8N4V1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		71978 [Q8N4V1-1]
71979 [Q8N4V1-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q8N4V1-1 [Q8N4V1-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N4V1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N4V1

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8N4V1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169446 Expressed in 205 organ(s), highest expression level in forebrain

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N4V1 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA032037

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the ER membrane protein complex (EMC).

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		125021, 124 interactors

Protein interaction database and analysis system

More...IntActi		Q8N4V1, 158 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000306220

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the membrane magnesium transporter (TC 1.A.67) family. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3918 Eukaryota
ENOG4111TZW LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00510000047104

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000244123

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N4V1

KEGG Orthology (KO)

More...KOi		K23566

Identification of Orthologs from Complete Genome Data

More...OMAi		WRSEMKR

Database of Orthologous Groups

More...OrthoDBi		1558871at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N4V1

TreeFam database of animal gene trees

More...TreeFami		TF323267

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018937 Magnesium_transport

Pfam protein domain database

More...Pfami		View protein in Pfam
PF10270 MMgT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N4V1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPSLWKGLV GIGLFALAHA AFSAAQHRSY MRLTEKEDES LPIDIVLQTL 
        60         70         80         90        100
LAFAVTCYGI VHIAGEFKDM DATSELKNKT FDTLRNHPSF YVFNHRGRVL 
       110        120        130 
FRPSDTANSS NQDALSSNTS LKLRKLESLR R
Length:131
Mass (Da):14,686
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDF6255A8172C6016
GO
Isoform 2 (identifier: Q8N4V1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTPLGSGPPREASIAQPSGFSTTETLCAQDFSDVIFLRRADTRRWKKKQLRRPSLLLLGCCSFGIM

Note: No experimental confirmation available.
Show »
Length:196
Mass (Da):21,881
Checksum:i35F422071C402B5C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364881M → MTPLGSGPPREASIAQPSGF STTETLCAQDFSDVIFLRRA DTRRWKKKQLRRPSLLLLGC CSFGIM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK295829 mRNA Translation: BAG58645.1
AK312409 mRNA Translation: BAG35322.1
AL732579 Genomic DNA No translation available.
AL953870 Genomic DNA No translation available.
CH471150 Genomic DNA Translation: EAW88483.1
CH471150 Genomic DNA Translation: EAW88485.1
BC033588 mRNA Translation: AAH33588.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14653.1 [Q8N4V1-1]

NCBI Reference Sequences

More...RefSeqi		NP_001316929.1, NM_001330000.1 [Q8N4V1-1]
NP_775741.1, NM_173470.2 [Q8N4V1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000305963; ENSP00000306220; ENSG00000169446 [Q8N4V1-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		93380

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:93380

UCSC genome browser

More...UCSCi		uc004ezi.2 human [Q8N4V1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK295829 mRNA Translation: BAG58645.1
AK312409 mRNA Translation: BAG35322.1
AL732579 Genomic DNA No translation available.
AL953870 Genomic DNA No translation available.
CH471150 Genomic DNA Translation: EAW88483.1
CH471150 Genomic DNA Translation: EAW88485.1
BC033588 mRNA Translation: AAH33588.1
CCDSiCCDS14653.1 [Q8N4V1-1]
RefSeqiNP_001316929.1, NM_001330000.1 [Q8N4V1-1]
NP_775741.1, NM_173470.2 [Q8N4V1-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi125021, 124 interactors
IntActiQ8N4V1, 158 interactors
STRINGi9606.ENSP00000306220

Protein family/group databases

TCDBi3.A.27.1.1 the c-terminal tail-anchored membrane protein biogenesis/ insertion complex-2 (tamp-b2) family

PTM databases

iPTMnetiQ8N4V1
PhosphoSitePlusiQ8N4V1
SwissPalmiQ8N4V1

Polymorphism and mutation databases

BioMutaiMMGT1
DMDMi74751006

Proteomic databases

EPDiQ8N4V1
jPOSTiQ8N4V1
MassIVEiQ8N4V1
MaxQBiQ8N4V1
PaxDbiQ8N4V1
PeptideAtlasiQ8N4V1
PRIDEiQ8N4V1
ProteomicsDBi71978 [Q8N4V1-1]
71979 [Q8N4V1-2]
TopDownProteomicsiQ8N4V1-1 [Q8N4V1-1]

Genome annotation databases

EnsembliENST00000305963; ENSP00000306220; ENSG00000169446 [Q8N4V1-1]
GeneIDi93380
KEGGihsa:93380
UCSCiuc004ezi.2 human [Q8N4V1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		93380

GeneCards: human genes, protein and diseases

More...GeneCardsi		MMGT1
HGNCiHGNC:28100 MMGT1
HPAiHPA032037
neXtProtiNX_Q8N4V1
OpenTargetsiENSG00000169446
PharmGKBiPA164723074

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3918 Eukaryota
ENOG4111TZW LUCA
GeneTreeiENSGT00510000047104
HOGENOMiHOG000244123
InParanoidiQ8N4V1
KOiK23566
OMAiWRSEMKR
OrthoDBi1558871at2759
PhylomeDBiQ8N4V1
TreeFamiTF323267

Enzyme and pathway databases

ReactomeiR-HSA-5223345 Miscellaneous transport and binding events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MMGT1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		93380
PharosiQ8N4V1

Protein Ontology

More...PROi		PR:Q8N4V1

Gene expression databases

BgeeiENSG00000169446 Expressed in 205 organ(s), highest expression level in forebrain
GenevisibleiQ8N4V1 HS

Family and domain databases

InterProiView protein in InterPro
IPR018937 Magnesium_transport
PfamiView protein in Pfam
PF10270 MMgT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMMGT1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N4V1
Secondary accession number(s): B2R625
, B4DIY3, D3DWG7, Q5JPP7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 1, 2002
Last modified: October 16, 2019
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again