Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ninein

Gene

NIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Centrosomal protein required in the positioning and anchorage of the microtubule minus-end in epithelial cells (PubMed:15190203, PubMed:23386061). May also act as a centrosome maturation factor (PubMed:11956314). May play a role in microtubule nucleation, by recruiting the gamma-tubulin ring complex to the centrosome (PubMed:15190203). Overexpression does not perturb nucleation or elongation of microtubules but suppresses release of microtubules (PubMed:15190203). Required for centriole organization and microtubule anchoring at the mother centriole (PubMed:23386061).3 Publications

Miscellaneous

Antibodies against NIN are present in sera from patients with autoimmune diseases that developed autoantibodies against centrosomal proteins.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi245 – 252GTPSequence analysis8
Nucleotide bindingi300 – 304GTPSequence analysis5
Nucleotide bindingi420 – 423GTPSequence analysis4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8N4C6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ninein
Short name:
hNinein
Alternative name(s):
Glycogen synthase kinase 3 beta-interacting protein
Short name:
GSK3B-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NIN
Synonyms:KIAA1565
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000100503.23

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14906 NIN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608684 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N4C6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Seckel syndrome 7 (SCKL7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.
See also OMIM:614851
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0690831222Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant dbSNP:rs187464517EnsemblClinVar.1
Natural variantiVAR_0690841709N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant dbSNP:rs387907308EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Dwarfism, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
51199

MalaCards human disease database

More...
MalaCardsi
NIN
MIMi614851 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000100503

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
319675 Microcephalic primordial dwarfism, Dauber type

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31630

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NIN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033487

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000968441 – 2090NineinAdd BLAST2090

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei152PhosphoserineCombined sources1
Modified residuei269PhosphoserineBy similarity1
Modified residuei1550PhosphoserineCombined sources1
Modified residuei1837PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by AURKA/Aurora kinase A and PKA kinases but not CK2 or AURKB/ Aurora kinase B.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N4C6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N4C6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N4C6

PeptideAtlas

More...
PeptideAtlasi
Q8N4C6

PRoteomics IDEntifications database

More...
PRIDEi
Q8N4C6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71907
71908 [Q8N4C6-10]
71909 [Q8N4C6-11]
71910 [Q8N4C6-2]
71911 [Q8N4C6-4]
71912 [Q8N4C6-5]
71913 [Q8N4C6-6]
71914 [Q8N4C6-7]
71915 [Q8N4C6-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N4C6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N4C6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Highly expressed in heart and skeletal muscle. Isoform 1 is more expressed than isoform 5.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In interphase cells, it is localized in the centrosome. Decreases in metaphase and anaphase and reappears in telophase.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100503 Expressed in 199 organ(s), highest expression level in amniotic fluid

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N4C6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N4C6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA005939
HPA070691

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer. Interacts with GSK3B/GSK3-beta via its C-terminal domain (PubMed:11004522). Interacts with C14ORF166, such interaction may prevent its phosphorylation by GSK3B (PubMed:15147888). Interacts with AUNIP (via N-terminus) (PubMed:20596670). Identified in a complex with AUNIP and AURKA (PubMed:20596670). Interacts with CCDC120 (PubMed:28422092). Interacts (via C-terminus) with CEP250 (By similarity). Interacts with CEP170 (By similarity). Interacts with the gamma-tubulin ring complex component TUBGCP3 (By similarity). Interacts with gamma-tubulin (By similarity). Isoform 6 does not interact with CEP170 or CEP250 (By similarity).By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119372, 120 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N4C6, 108 interactors

Molecular INTeraction database

More...
MINTi
Q8N4C6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371472

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8N4C6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N4C6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 43EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini42 – 77EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini182 – 217EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini219 – 252EF-hand 4PROSITE-ProRule annotationAdd BLAST34
Domaini317 – 352EF-hand 5PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni802 – 1505Important for interaction with CEP170By similarityAdd BLAST704

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili357 – 570Sequence analysisAdd BLAST214
Coiled coili625 – 1027Sequence analysisAdd BLAST403
Coiled coili1068 – 1099Sequence analysisAdd BLAST32
Coiled coili1181 – 1341Sequence analysisAdd BLAST161
Coiled coili1441 – 1816Sequence analysisAdd BLAST376
Coiled coili1854 – 1885Sequence analysisAdd BLAST32
Coiled coili1922 – 2067Sequence analysisAdd BLAST146

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

There is conflicting information regarding the regions required for centrosomal localization. One study shows that the region 1601-1682 is necessary and sufficient for targeting to the centrosome (PubMed:12927815). Another study shows that a separate region, 1291-1575, is important for centrosomal localization (PubMed:15190203). However, a third study shows that the coiled-coil region (373-1885) is not sufficient for centrosomal localization and instead localizes to cytoplasmic speckles (By similarity). The observed differences might be due to oligomerization of the longer coiled-coil domain-containing sequence, which would mask the shorter centrosomal targeting sequences (By similarity).By similarity2 Publications
The N-terminal domain is important for targeting to the mother centriole, although it is not sufficient by itself for centrosomal localization.By similarity

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK59 Eukaryota
ENOG410Z1RR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00660000095541

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293170

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052623

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N4C6

KEGG Orthology (KO)

More...
KOi
K16476

Identification of Orthologs from Complete Genome Data

More...
OMAi
MDEAEQD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00XA

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N4C6

TreeFam database of animal gene trees

More...
TreeFami
TF325139

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR029664 NIN

The PANTHER Classification System

More...
PANTHERi
PTHR18905:SF11 PTHR18905:SF11, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50222 EF_HAND_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N4C6-1) [UniParc]FASTAAdd to basket
Also known as: Lm

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDEVEQDQHE ARLKELFDSF DTTGTGSLGQ EELTDLCHML SLEEVAPVLQ
60 70 80 90 100
QTLLQDNLLG RVHFDQFKEA LILILSRTLS NEEHFQEPDC SLEAQPKYVR
110 120 130 140 150
GGKRYGRRSL PEFQESVEEF PEVTVIEPLD EEARPSHIPA GDCSEHWKTQ
160 170 180 190 200
RSEEYEAEGQ LRFWNPDDLN ASQSGSSPPQ DWIEEKLQEV CEDLGITRDG
210 220 230 240 250
HLNRKKLVSI CEQYGLQNVD GEMLEEVFHN LDPDGTMSVE DFFYGLFKNG
260 270 280 290 300
KSLTPSASTP YRQLKRHLSM QSFDESGRRT TTSSAMTSTI GFRVFSCLDD
310 320 330 340 350
GMGHASVERI LDTWQEEGIE NSQEILKALD FSLDGNINLT ELTLALENEL
360 370 380 390 400
LVTKNSIHQA ALASFKAEIR HLLERVDQVV REKEKLRSDL DKAEKLKSLM
410 420 430 440 450
ASEVDDHHAA IERRNEYNLR KLDEEYKERI AALKNELRKE REQILQQAGK
460 470 480 490 500
QRLELEQEIE KAKTEENYIR DRLALSLKEN SRLENELLEN AEKLAEYENL
510 520 530 540 550
TNKLQRNLEN VLAEKFGDLD PSSAEFFLQE ERLTQMRNEY ERQCRVLQDQ
560 570 580 590 600
VDELQSELEE YRAQGRVLRL PLKNSPSEEV EANSGGIEPE HGLGSEECNP
610 620 630 640 650
LNMSIEAELV IEQMKEQHHR DICCLRLELE DKVRHYEKQL DETVVSCKKA
660 670 680 690 700
QENMKQRHEN ETHTLEKQIS DLKNEIAELQ GQAAVLKEAH HEATCRHEEE
710 720 730 740 750
KKQLQVKLEE EKTHLQEKLR LQHEMELKAR LTQAQASFER EREGLQSSAW
760 770 780 790 800
TEEKVRGLTQ ELEQFHQEQL TSLVEKHTLE KEELRKELLE KHQRELQEGR
810 820 830 840 850
EKMETECNRR TSQIEAQFQS DCQKVTERCE SALQSLEGRY RQELKDLQEQ
860 870 880 890 900
QREEKSQWEF EKDELTQECA EAQELLKETL KREKTTSLVL TQEREMLEKT
910 920 930 940 950
YKEHLNSMVV ERQQLLQDLE DLRNVSETQQ SLLSDQILEL KSSHKRELRE
960 970 980 990 1000
REEVLCQAGA SEQLASQRLE RLEMEHDQER QEMMSKLLAM ENIHKATCET
1010 1020 1030 1040 1050
ADRERAEMST EISRLQSKIK EMQQATSPLS MLQSGCQVIG EEEVEGDGAL
1060 1070 1080 1090 1100
SLLQQGEQLL EENGDVLLSL QRAHEQAVKE NVKMATEISR LQQRLQKLEP
1110 1120 1130 1140 1150
GLVMSSCLDE PATEFFGNTA EQTEQFLQQN RTKQVEGVTR RHVLSDLEDD
1160 1170 1180 1190 1200
EVRDLGSTGT SSVQRQEVKI EESEASVEGF SELENSEETR TESWELKNQI
1210 1220 1230 1240 1250
SQLQEQLMML CADCDRASEK KQDLLFDVSV LKKKLKMLER IPEASPKYKL
1260 1270 1280 1290 1300
LYEDVSREND CLQEELRMME TRYDEALENN KELTAEVFRL QDELKKMEEV
1310 1320 1330 1340 1350
TETFLSLEKS YDEVKIENEG LNVLVLRLQG KIEKLQESVV QRCDCCLWEA
1360 1370 1380 1390 1400
SLENLEIEPD GNILQLNQTL EECVPRVRSV HHVIEECKQE NQYLEGNTQL
1410 1420 1430 1440 1450
LEKVKAHEIA WLHGTIQTHQ ERPRVQNQVI LEENTTLLGF QDKHFQHQAT
1460 1470 1480 1490 1500
IAELELEKTK LQELTRKLKE RVTILVKQKD VLSHGEKEEE LKAMMHDLQI
1510 1520 1530 1540 1550
TCSEMQQKVE LLRYESEKLQ QENSILRNEI TTLNEEDSIS NLKLGTLNGS
1560 1570 1580 1590 1600
QEEMWQKTET VKQENAAVQK MVENLKKQIS ELKIKNQQLD LENTELSQKN
1610 1620 1630 1640 1650
SQNQEKLQEL NQRLTEMLCQ KEKEPGNSAL EEREQEKFNL KEELERCKVQ
1660 1670 1680 1690 1700
SSTLVSSLEA ELSEVKIQTH IVQQENHLLK DELEKMKQLH RCPDLSDFQQ
1710 1720 1730 1740 1750
KISSVLSYNE KLLKEKEALS EELNSCVDKL AKSSLLEHRI ATMKQEQKSW
1760 1770 1780 1790 1800
EHQSASLKSQ LVASQEKVQN LEDTVQNVNL QMSRMKSDLR VTQQEKEALK
1810 1820 1830 1840 1850
QEVMSLHKQL QNAGGKSWAP EIATHPSGLH NQQKRLSWDK LDHLMNEEQQ
1860 1870 1880 1890 1900
LLWQENERLQ TMVQNTKAEL THSREKVRQL ESNLLPKHQK HLNPSGTMNP
1910 1920 1930 1940 1950
TEQEKLSLKR ECDQFQKEQS PANRKVSQMN SLEQELETIH LENEGLKKKQ
1960 1970 1980 1990 2000
VKLDEQLMEM QHLRSTATPS PSPHAWDLQL LQQQACPMVP REQFLQLQRQ
2010 2020 2030 2040 2050
LLQAERINQH LQEELENRTS ETNTPQGNQE QLVTVMEERM IEVEQKLKLV
2060 2070 2080 2090
KRLLQEKVNQ LKEQVSLPGH LCSPTSHSSF NSSFTSLYCH
Length:2,090
Mass (Da):243,249
Last modified:November 2, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i51D27CD38A369209
GO
Isoform 2 (identifier: Q8N4C6-2) [UniParc]FASTAAdd to basket
Also known as: Isotype 3

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,073
Mass (Da):241,191
Checksum:i784E25AE5D1C68DE
GO
Isoform 3 (identifier: Q8N4C6-10) [UniParc]FASTAAdd to basket
Also known as: Isotype 2

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,116
Mass (Da):246,135
Checksum:i0A9CEF8ECA2BF346
GO
Isoform 4 (identifier: Q8N4C6-4) [UniParc]FASTAAdd to basket
Also known as: Isotype 1

The sequence of this isoform differs from the canonical sequence as follows:
     492-508: Missing.
     2027-2046: GNQEQLVTVMEERMIEVEQK → ALLPEQRAVHADSYRRIGHL
     2047-2090: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:2,029
Mass (Da):236,135
Checksum:iF994E939809252CB
GO
Isoform 5 (identifier: Q8N4C6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTD → MAEVTVPRVY...HRKIQHVKNE

Show »
Length:2,096
Mass (Da):243,889
Checksum:i32552AFD21D13A70
GO
Isoform 6 (identifier: Q8N4C6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.
     1555-1555: Missing.
     1960-1988: MQHLRSTATPSPSPHAWDLQLLQQQACPM → NSVVGSSREGCSSLPEIVCEDAAPEVHCDA
     1989-2090: Missing.

Note: No experimental confirmation available.
Show »
Length:1,275
Mass (Da):147,799
Checksum:iA34D34D74D9B861C
GO
Isoform 7 (identifier: Q8N4C6-7) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     2065-2090: VSLPGHLCSPTSHSSFNSSFTSLYCH → LCKNTKADAM...PLTSTPPLRS

Note: No experimental confirmation available.
Show »
Length:2,133
Mass (Da):248,194
Checksum:i7B4B1C5A69FD4424
GO
Isoform 8 (identifier: Q8N4C6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.

Note: No experimental confirmation available.
Show »
Length:2,052
Mass (Da):238,941
Checksum:i77E187FF00857A7D
GO
Isoform 9 (identifier: Q8N4C6-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-1512: Missing.

Note: No experimental confirmation available.
Show »
Length:1,377
Mass (Da):160,136
Checksum:i19AE5E3800593B03
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J066C9J066_HUMAN
Ninein
NIN
2,046Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDJ4H0YDJ4_HUMAN
Ninein
NIN
1,537Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9KV85H9KV85_HUMAN
Ninein
NIN
1,581Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN67E9PN67_HUMAN
Ninein
NIN
1,989Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJH9E9PJH9_HUMAN
Ninein
NIN
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C162H7C162_HUMAN
Ninein
NIN
396Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J215A0A0B4J215_HUMAN
Ninein
NIN
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN85R4GN85_HUMAN
Ninein
NIN
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH65521 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH65521 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAK00628 differs from that shown. Several sequencing errors.Curated
The sequence AAK00629 differs from that shown. Several sequencing errors and frameshifts.Curated
The sequence AAK00630 differs from that shown. Several sequencing errors.Curated
The sequence BAB13391 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB15640 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti137H → Y in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti137H → Y in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti177S → F in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti203N → D in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti223M → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti295F → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti369I → V in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti399L → S in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti568L → F in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti809R → I in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti812S → T in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti945K → I in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti977D → A in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti980R → G in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1054Q → H in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti1067L → F in AAG33512 (PubMed:11162463).Curated1
Sequence conflicti1070L → Q in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1150D → G in AAF23015 (PubMed:11004522).Curated1
Sequence conflicti1237M → I in AAF23015 (PubMed:11004522).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0194531111P → A. Corresponds to variant dbSNP:rs2236316EnsemblClinVar.1
Natural variantiVAR_0512351125Q → P3 PublicationsCorresponds to variant dbSNP:rs12882191Ensembl.1
Natural variantiVAR_0690831222Q → R in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant dbSNP:rs187464517EnsemblClinVar.1
Natural variantiVAR_0194541320G → E4 PublicationsCorresponds to variant dbSNP:rs2073347Ensembl.1
Natural variantiVAR_0690841709N → S in SCKL7; does not disrupt protein expression or localization or affect mitotic functions in an obvious way. 1 PublicationCorresponds to variant dbSNP:rs387907308EnsemblClinVar.1
Natural variantiVAR_0194551837S → T. Corresponds to variant dbSNP:rs12717411EnsemblClinVar.1
Natural variantiVAR_0512361934Q → E. Corresponds to variant dbSNP:rs2295847EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0400391 – 38Missing in isoform 8. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0109501 – 35MDEVE…EELTD → MAEVTVPRVYVVFGIHCIMA KASSDVQVSGFHRKIQHVKN E in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_010952492 – 508Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_010953800 – 1512Missing in isoform 6 and isoform 9. 2 PublicationsAdd BLAST713
Alternative sequenceiVSP_0109541555Missing in isoform 6. 1 Publication1
Alternative sequenceiVSP_0109551960 – 1988MQHLR…QACPM → NSVVGSSREGCSSLPEIVCE DAAPEVHCDA in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0109561989 – 2090Missing in isoform 6. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_0109572027 – 2046GNQEQ…EVEQK → ALLPEQRAVHADSYRRIGHL in isoform 4. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_0109582047 – 2090Missing in isoform 4. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0109602065 – 2090VSLPG…SLYCH → LCKNTKADAMVKDLYVENAQ LLKALEVTEQRQKTAEKKNY LLEEKIASLSNIVRNLTPAP LTSTPPLRS in isoform 3 and isoform 7. 2 PublicationsAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF212162 mRNA Translation: AAF23015.2
AF302773 mRNA Translation: AAG33512.2
AF223937 mRNA Translation: AAK00628.1 Sequence problems.
AF223938 mRNA Translation: AAK00629.1 Sequence problems.
AF223939 mRNA Translation: AAK00630.1 Sequence problems.
AB046785 mRNA Translation: BAB13391.2 Different initiation.
AL133485 Genomic DNA No translation available.
AL606834 Genomic DNA No translation available.
BC034708 mRNA Translation: AAH34708.2
BC065521 mRNA Translation: AAH65521.1 Sequence problems.
BC090932 mRNA Translation: AAH90932.1
AY027794 mRNA Translation: AAK27375.1
AY027795 mRNA Translation: AAK27376.1
AY027796 mRNA Translation: AAK27377.1
AF186776 mRNA Translation: AAG17027.1
AK027054 mRNA Translation: BAB15640.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32078.2 [Q8N4C6-11]
CCDS32079.1 [Q8N4C6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057434.4, NM_016350.4 [Q8N4C6-11]
NP_065972.3, NM_020921.3
NP_891989.2, NM_182944.2
NP_891991.1, NM_182946.1
XP_011535125.1, XM_011536823.2 [Q8N4C6-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.310429
Hs.569387

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000245441; ENSP00000245441; ENSG00000100503 [Q8N4C6-7]
ENST00000324330; ENSP00000324210; ENSG00000100503 [Q8N4C6-11]
ENST00000382041; ENSP00000371472; ENSG00000100503 [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503 [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503 [Q8N4C6-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51199

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51199

UCSC genome browser

More...
UCSCi
uc001wyi.3 human [Q8N4C6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212162 mRNA Translation: AAF23015.2
AF302773 mRNA Translation: AAG33512.2
AF223937 mRNA Translation: AAK00628.1 Sequence problems.
AF223938 mRNA Translation: AAK00629.1 Sequence problems.
AF223939 mRNA Translation: AAK00630.1 Sequence problems.
AB046785 mRNA Translation: BAB13391.2 Different initiation.
AL133485 Genomic DNA No translation available.
AL606834 Genomic DNA No translation available.
BC034708 mRNA Translation: AAH34708.2
BC065521 mRNA Translation: AAH65521.1 Sequence problems.
BC090932 mRNA Translation: AAH90932.1
AY027794 mRNA Translation: AAK27375.1
AY027795 mRNA Translation: AAK27376.1
AY027796 mRNA Translation: AAK27377.1
AF186776 mRNA Translation: AAG17027.1
AK027054 mRNA Translation: BAB15640.1 Different initiation.
CCDSiCCDS32078.2 [Q8N4C6-11]
CCDS32079.1 [Q8N4C6-1]
RefSeqiNP_057434.4, NM_016350.4 [Q8N4C6-11]
NP_065972.3, NM_020921.3
NP_891989.2, NM_182944.2
NP_891991.1, NM_182946.1
XP_011535125.1, XM_011536823.2 [Q8N4C6-5]
UniGeneiHs.310429
Hs.569387

3D structure databases

ProteinModelPortaliQ8N4C6
SMRiQ8N4C6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119372, 120 interactors
IntActiQ8N4C6, 108 interactors
MINTiQ8N4C6
STRINGi9606.ENSP00000371472

PTM databases

iPTMnetiQ8N4C6
PhosphoSitePlusiQ8N4C6

Polymorphism and mutation databases

BioMutaiNIN
DMDMi311033487

Proteomic databases

EPDiQ8N4C6
MaxQBiQ8N4C6
PaxDbiQ8N4C6
PeptideAtlasiQ8N4C6
PRIDEiQ8N4C6
ProteomicsDBi71907
71908 [Q8N4C6-10]
71909 [Q8N4C6-11]
71910 [Q8N4C6-2]
71911 [Q8N4C6-4]
71912 [Q8N4C6-5]
71913 [Q8N4C6-6]
71914 [Q8N4C6-7]
71915 [Q8N4C6-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245441; ENSP00000245441; ENSG00000100503 [Q8N4C6-7]
ENST00000324330; ENSP00000324210; ENSG00000100503 [Q8N4C6-11]
ENST00000382041; ENSP00000371472; ENSG00000100503 [Q8N4C6-1]
ENST00000382043; ENSP00000371474; ENSG00000100503 [Q8N4C6-11]
ENST00000530997; ENSP00000436092; ENSG00000100503 [Q8N4C6-7]
GeneIDi51199
KEGGihsa:51199
UCSCiuc001wyi.3 human [Q8N4C6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51199
DisGeNETi51199
EuPathDBiHostDB:ENSG00000100503.23

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NIN
HGNCiHGNC:14906 NIN
HPAiHPA005939
HPA070691
MalaCardsiNIN
MIMi608684 gene
614851 phenotype
neXtProtiNX_Q8N4C6
OpenTargetsiENSG00000100503
Orphaneti319675 Microcephalic primordial dwarfism, Dauber type
PharmGKBiPA31630

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IK59 Eukaryota
ENOG410Z1RR LUCA
GeneTreeiENSGT00660000095541
HOGENOMiHOG000293170
HOVERGENiHBG052623
InParanoidiQ8N4C6
KOiK16476
OMAiMDEAEQD
OrthoDBiEOG091G00XA
PhylomeDBiQ8N4C6
TreeFamiTF325139

Enzyme and pathway databases

SIGNORiQ8N4C6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NIN human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NIN_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51199

Protein Ontology

More...
PROi
PR:Q8N4C6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100503 Expressed in 199 organ(s), highest expression level in amniotic fluid
ExpressionAtlasiQ8N4C6 baseline and differential
GenevisibleiQ8N4C6 HS

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR029664 NIN
PANTHERiPTHR18905:SF11 PTHR18905:SF11, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNIN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N4C6
Secondary accession number(s): A6NDB8
, B7WPA3, C9JSB6, C9JSG2, C9JXL2, Q5BKU3, Q6P0P6, Q9BWU6, Q9C012, Q9C013, Q9C014, Q9H5I6, Q9HAT7, Q9HBY5, Q9HCK7, Q9UH61
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: November 2, 2010
Last modified: December 5, 2018
This is version 155 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again