Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (02 Jun 2021)
Sequence version 2 (16 Aug 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Polypeptide N-acetylgalactosaminyltransferase 16

Gene

GALNT16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=251 µM for Muc5AC1 Publication
  2. KM=310 µM for Muc5AC-31 Publication
  3. KM=390 µM for Muc5AC-131 Publication
  4. KM=332 µM for EA21 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei163SubstrateBy similarity1
    Binding sitei188SubstrateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi211ManganeseBy similarity1
    Binding sitei212SubstrateBy similarity1
    Metal bindingi213ManganeseBy similarity1
    Binding sitei317SubstrateBy similarity1
    Metal bindingi345ManganeseBy similarity1
    Binding sitei348SubstrateBy similarity1
    Binding sitei351SubstrateBy similarity1
    Binding sitei353SubstrateBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandLectin, Manganese, Metal-binding

    Enzyme and pathway databases

    Pathway Commons web resource for biological pathway data

    More...
    PathwayCommonsi
    Q8N428

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-913709, O-linked glycosylation of mucins

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q8N428

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00378

    Protein family/group databases

    Carbohydrate-Active enZymes

    More...
    CAZyi
    CBM13, Carbohydrate-Binding Module Family 13
    GT27, Glycosyltransferase Family 27

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Polypeptide N-acetylgalactosaminyltransferase 16 (EC:2.4.1.41)
    Alternative name(s):
    Polypeptide GalNAc transferase 16
    Short name:
    GalNAc-T16
    Polypeptide GalNAc transferase-like protein 1
    Short name:
    GalNAc-T-like protein 1
    Short name:
    pp-GaNTase-like protein 1
    Polypeptide N-acetylgalactosaminyltransferase-like protein 1
    Protein-UDP acetylgalactosaminyltransferase-like protein 1
    UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:GALNT16
    Synonyms:GALNTL1, KIAA1130
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:23233, GALNT16

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    615132, gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q8N428

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...
    VEuPathDBi
    HostDB:ENSG00000100626.16

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 6CytoplasmicSequence analysis6
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei7 – 26Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
    Topological domaini27 – 558LumenalSequence analysisAdd BLAST532

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    57452

    Open Targets

    More...
    OpenTargetsi
    ENSG00000100626

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134991608

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q8N428, Tbio

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    GALNT16

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    51316024

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000591351 – 558Polypeptide N-acetylgalactosaminyltransferase 16Add BLAST558

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi113 ↔ 340PROSITE-ProRule annotation
    Disulfide bondi331 ↔ 409PROSITE-ProRule annotation
    Disulfide bondi441 ↔ 460PROSITE-ProRule annotation
    Disulfide bondi486 ↔ 506PROSITE-ProRule annotation
    Disulfide bondi530 ↔ 543PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q8N428

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q8N428

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q8N428

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q8N428

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q8N428

    PeptideAtlas

    More...
    PeptideAtlasi
    Q8N428

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q8N428

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    71869 [Q8N428-1]
    71870 [Q8N428-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q8N428

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q8N428

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000100626, Expressed in heart and 179 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q8N428, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q8N428, HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    ENSG00000100626, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...
    BioGRIDi
    121524, 9 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q8N428, 9 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000336729

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q8N428, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q8N428

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini428 – 555Ricin B-type lectinPROSITE-ProRule annotationAdd BLAST128

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni33 – 54DisorderedSequence analysisAdd BLAST22
    Regioni122 – 227Catalytic subdomain AAdd BLAST106
    Regioni286 – 348Catalytic subdomain BAdd BLAST63

    <p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3738, Eukaryota

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000158846

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_013477_0_2_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q8N428

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    DDPYREH

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q8N428

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313267

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd00161, RICIN, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.90.550.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR001173, Glyco_trans_2-like
    IPR029044, Nucleotide-diphossugar_trans
    IPR035992, Ricin_B-like_lectins
    IPR000772, Ricin_B_lectin

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00535, Glycos_transf_2, 1 hit
    PF00652, Ricin_B_lectin, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00458, RICIN, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF50370, SSF50370, 1 hit
    SSF53448, SSF53448, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS50231, RICIN_B_LECTIN, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q8N428-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRKIRANAIA ILTVAWILGT FYYLWQDNRA HAASSGGRGA QRAGRRSEQL
    60 70 80 90 100
    REDRTIPLIV TGTPSKGFDE KAYLSAKQLK AGEDPYRQHA FNQLESDKLS
    110 120 130 140 150
    PDRPIRDTRH YSCPSVSYSS DLPATSVIIT FHNEARSTLL RTVKSVLNRT
    160 170 180 190 200
    PANLIQEIIL VDDFSSDPED CLLLTRIPKV KCLRNDRREG LIRSRVRGAD
    210 220 230 240 250
    VAAATVLTFL DSHCEVNTEW LPPMLQRVKE DHTRVVSPII DVISLDNFAY
    260 270 280 290 300
    LAASADLRGG FDWSLHFKWE QIPLEQKMTR TDPTRPIRTP VIAGGIFVID
    310 320 330 340 350
    KSWFNHLGKY DAQMDIWGGE NFELSFRVWM CGGSLEIVPC SRVGHVFRKR
    360 370 380 390 400
    HPYNFPEGNA LTYIRNTKRT AEVWMDEYKQ YYYEARPSAI GKAFGSVATR
    410 420 430 440 450
    IEQRKKMNCK SFRWYLENVY PELTVPVKEA LPGIIKQGVN CLESQGQNTA
    460 470 480 490 500
    GDFLLGMGIC RGSAKNPQPA QAWLFSDHLI QQQGKCLAAT STLMSSPGSP
    510 520 530 540 550
    VILQMCNPRE GKQKWRRKGS FIQHSVSGLC LETKPAQLVT SKCQADAQAQ

    QWQLLPHT
    Length:558
    Mass (Da):63,074
    Last modified:August 16, 2004 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF35C5606B5291B8
    GO
    Isoform 2 (identifier: Q8N428-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         514-558: KWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPHT → VSLLASGPEAQQPEGPCLRVADLGRRAPD

    Show »
    Length:542
    Mass (Da):60,972
    Checksum:i1E517B517B2568A9
    GO

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA86444 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055848201V → M2 PublicationsCorresponds to variant dbSNP:rs12879377Ensembl.1
    Natural variantiVAR_061195497P → S. Corresponds to variant dbSNP:rs59840366Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011231514 – 558KWRRK…LLPHT → VSLLASGPEAQQPEGPCLRV ADLGRRAPD in isoform 2. 2 PublicationsAdd BLAST45

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB032956 mRNA Translation: BAA86444.1 Different initiation.
    AB078143 mRNA Translation: BAD93178.1
    AK289745 mRNA Translation: BAF82434.1
    CH471061 Genomic DNA Translation: EAW80987.1
    BC036812 mRNA Translation: AAH36812.2
    BC098578 mRNA Translation: AAH98578.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS32107.1 [Q8N428-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001161840.1, NM_001168368.1 [Q8N428-1]
    NP_065743.2, NM_020692.2 [Q8N428-1]
    XP_011535307.1, XM_011537005.1 [Q8N428-1]
    XP_011535308.1, XM_011537006.2 [Q8N428-1]
    XP_016876987.1, XM_017021498.1 [Q8N428-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000337827; ENSP00000336729; ENSG00000100626 [Q8N428-1]
    ENST00000448469; ENSP00000402970; ENSG00000100626 [Q8N428-1]
    ENST00000553471; ENSP00000451420; ENSG00000100626 [Q8N428-2]
    ENST00000553669; ENSP00000451200; ENSG00000100626 [Q8N428-2]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    57452

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:57452

    UCSC genome browser

    More...
    UCSCi
    uc001xla.3, human [Q8N428-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    <p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

    Functional Glycomics Gateway - GTase

    Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB032956 mRNA Translation: BAA86444.1 Different initiation.
    AB078143 mRNA Translation: BAD93178.1
    AK289745 mRNA Translation: BAF82434.1
    CH471061 Genomic DNA Translation: EAW80987.1
    BC036812 mRNA Translation: AAH36812.2
    BC098578 mRNA Translation: AAH98578.1
    CCDSiCCDS32107.1 [Q8N428-1]
    RefSeqiNP_001161840.1, NM_001168368.1 [Q8N428-1]
    NP_065743.2, NM_020692.2 [Q8N428-1]
    XP_011535307.1, XM_011537005.1 [Q8N428-1]
    XP_011535308.1, XM_011537006.2 [Q8N428-1]
    XP_016876987.1, XM_017021498.1 [Q8N428-1]

    3D structure databases

    SMRiQ8N428
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGRIDi121524, 9 interactors
    IntActiQ8N428, 9 interactors
    STRINGi9606.ENSP00000336729

    Protein family/group databases

    CAZyiCBM13, Carbohydrate-Binding Module Family 13
    GT27, Glycosyltransferase Family 27

    PTM databases

    iPTMnetiQ8N428
    PhosphoSitePlusiQ8N428

    Genetic variation databases

    BioMutaiGALNT16
    DMDMi51316024

    Proteomic databases

    EPDiQ8N428
    jPOSTiQ8N428
    MassIVEiQ8N428
    MaxQBiQ8N428
    PaxDbiQ8N428
    PeptideAtlasiQ8N428
    PRIDEiQ8N428
    ProteomicsDBi71869 [Q8N428-1]
    71870 [Q8N428-2]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    25033, 63 antibodies

    The DNASU plasmid repository

    More...
    DNASUi
    57452

    Genome annotation databases

    EnsembliENST00000337827; ENSP00000336729; ENSG00000100626 [Q8N428-1]
    ENST00000448469; ENSP00000402970; ENSG00000100626 [Q8N428-1]
    ENST00000553471; ENSP00000451420; ENSG00000100626 [Q8N428-2]
    ENST00000553669; ENSP00000451200; ENSG00000100626 [Q8N428-2]
    GeneIDi57452
    KEGGihsa:57452
    UCSCiuc001xla.3, human [Q8N428-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    57452
    DisGeNETi57452

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    GALNT16
    HGNCiHGNC:23233, GALNT16
    HPAiENSG00000100626, Low tissue specificity
    MIMi615132, gene
    neXtProtiNX_Q8N428
    OpenTargetsiENSG00000100626
    PharmGKBiPA134991608
    VEuPathDBiHostDB:ENSG00000100626.16

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3738, Eukaryota
    GeneTreeiENSGT00940000158846
    HOGENOMiCLU_013477_0_2_1
    InParanoidiQ8N428
    OMAiDDPYREH
    PhylomeDBiQ8N428
    TreeFamiTF313267

    Enzyme and pathway databases

    UniPathwayiUPA00378
    PathwayCommonsiQ8N428
    ReactomeiR-HSA-913709, O-linked glycosylation of mucins
    SABIO-RKiQ8N428

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...
    BioGRID-ORCSi
    57452, 7 hits in 976 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    GALNT16, human

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    57452
    PharosiQ8N428, Tbio

    Protein Ontology

    More...
    PROi
    PR:Q8N428
    RNActiQ8N428, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000100626, Expressed in heart and 179 other tissues
    ExpressionAtlasiQ8N428, baseline and differential
    GenevisibleiQ8N428, HS

    Family and domain databases

    CDDicd00161, RICIN, 1 hit
    Gene3Di3.90.550.10, 1 hit
    InterProiView protein in InterPro
    IPR001173, Glyco_trans_2-like
    IPR029044, Nucleotide-diphossugar_trans
    IPR035992, Ricin_B-like_lectins
    IPR000772, Ricin_B_lectin
    PfamiView protein in Pfam
    PF00535, Glycos_transf_2, 1 hit
    PF00652, Ricin_B_lectin, 1 hit
    SMARTiView protein in SMART
    SM00458, RICIN, 1 hit
    SUPFAMiSSF50370, SSF50370, 1 hit
    SSF53448, SSF53448, 1 hit
    PROSITEiView protein in PROSITE
    PS50231, RICIN_B_LECTIN, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGLT16_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N428
    Secondary accession number(s): Q4KMG3, Q58A55, Q9ULT9
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: August 16, 2004
    Last modified: June 2, 2021
    This is version 156 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with genetic variants
      List of human entries with genetic variants
    3. Human variants curated from literature reports
      Index of human variants curated from literature reports
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again