Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cohesin subunit SA-2

Gene

STAG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis.1 Publication

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Chromosome partition, Meiosis, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-1221632 Meiotic synapsis
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-9018519 Estrogen-dependent gene expression
SIGNORiQ8N3U4

Names & Taxonomyi

Protein namesi
Recommended name:
Cohesin subunit SA-2
Alternative name(s):
SCC3 homolog 2
Stromal antigen 2
Gene namesi
Name:STAG2
Synonyms:SA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000101972.18
HGNCiHGNC:11355 STAG2
MIMi300826 gene
neXtProtiNX_Q8N3U4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi10735
OpenTargetsiENSG00000101972
PharmGKBiPA36177

Polymorphism and mutation databases

BioMutaiSTAG2
DMDMi73621291

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001201851 – 1231Cohesin subunit SA-2Add BLAST1231

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei607N6-acetyllysineCombined sources1
Modified residuei1058PhosphoserineCombined sources1
Modified residuei1061PhosphoserineCombined sources1
Modified residuei1064PhosphoserineBy similarity1
Modified residuei1065PhosphoserineBy similarity1
Modified residuei1112PhosphothreonineCombined sources1
Modified residuei1177PhosphoserineCombined sources1
Modified residuei1178PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by PLK1. The large dissociation of cohesin from chromosome arms during prophase is partly due to its phosphorylation (By similarity).By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8N3U4
MaxQBiQ8N3U4
PaxDbiQ8N3U4
PeptideAtlasiQ8N3U4
PRIDEiQ8N3U4
ProteomicsDBi71836
71837 [Q8N3U4-2]

PTM databases

iPTMnetiQ8N3U4
PhosphoSitePlusiQ8N3U4

Expressioni

Gene expression databases

BgeeiENSG00000101972 Expressed in 246 organ(s), highest expression level in mucosa of paranasal sinus
CleanExiHS_STAG2
ExpressionAtlasiQ8N3U4 baseline and differential
GenevisibleiQ8N3U4 HS

Organism-specific databases

HPAiHPA002857

Interactioni

Subunit structurei

Interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1A or SMC1B) and SMC3, which are attached via their hinge domain, and RAD21 which link them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi115958, 51 interactors
CORUMiQ8N3U4
DIPiDIP-35418N
IntActiQ8N3U4, 21 interactors
MINTiQ8N3U4
STRINGi9606.ENSP00000218089

Structurei

Secondary structure

11231
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8N3U4
SMRiQ8N3U4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini293 – 378SCDPROSITE-ProRule annotationAdd BLAST86

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1096 – 1101Poly-Ser6

Sequence similaritiesi

Belongs to the SCC3 family.Curated

Phylogenomic databases

eggNOGiKOG2011 Eukaryota
COG5537 LUCA
GeneTreeiENSGT00390000014094
HOVERGENiHBG057636
InParanoidiQ8N3U4
KOiK06671
OMAiICDLLII
OrthoDBiEOG091G0195
PhylomeDBiQ8N3U4
TreeFamiTF314604

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR039662 Cohesin_Scc3/SA
IPR020839 SCD
IPR013721 STAG
PANTHERiPTHR11199 PTHR11199, 1 hit
PfamiView protein in Pfam
PF08514 STAG, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51425 SCD, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N3U4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIAAPEIPTD FNLLQESETH FSSDTDFEDI EGKNQKQGKG KTCKKGKKGP
60 70 80 90 100
AEKGKGGNGG GKPPSGPNRM NGHHQQNGVE NMMLFEVVKM GKSAMQSVVD
110 120 130 140 150
DWIESYKHDR DIALLDLINF FIQCSGCKGV VTAEMFRHMQ NSEIIRKMTE
160 170 180 190 200
EFDEDSGDYP LTMAGPQWKK FKSSFCEFIG VLVRQCQYSI IYDEYMMDTV
210 220 230 240 250
ISLLTGLSDS QVRAFRHTST LAAMKLMTAL VNVALNLSIN MDNTQRQYEA
260 270 280 290 300
ERNKMIGKRA NERLELLLQK RKELQENQDE IENMMNAIFK GVFVHRYRDA
310 320 330 340 350
IAEIRAICIE EIGIWMKMYS DAFLNDSYLK YVGWTMHDKQ GEVRLKCLTA
360 370 380 390 400
LQGLYYNKEL NSKLELFTSR FKDRIVSMTL DKEYDVAVQA IKLLTLVLQS
410 420 430 440 450
SEEVLTAEDC ENVYHLVYSA HRPVAVAAGE FLYKKLFSRR DPEEDGMMKR
460 470 480 490 500
RGRQGPNANL VKTLVFFFLE SELHEHAAYL VDSMWDCATE LLKDWECMNS
510 520 530 540 550
LLLEEPLSGE EALTDRQESA LIEIMLCTIR QAAECHPPVG RGTGKRVLTA
560 570 580 590 600
KEKKTQLDDR TKITELFAVA LPQLLAKYSV DAEKVTNLLQ LPQYFDLEIY
610 620 630 640 650
TTGRLEKHLD ALLRQIRNIV EKHTDTDVLE ACSKTYHALC NEEFTIFNRV
660 670 680 690 700
DISRSQLIDE LADKFNRLLE DFLQEGEEPD EDDAYQVLST LKRITAFHNA
710 720 730 740 750
HDLSKWDLFA CNYKLLKTGI ENGDMPEQIV IHALQCTHYV ILWQLAKITE
760 770 780 790 800
SSSTKEDLLR LKKQMRVFCQ ICQHYLTNVN TTVKEQAFTI LCDILMIFSH
810 820 830 840 850
QIMSGGRDML EPLVYTPDSS LQSELLSFIL DHVFIEQDDD NNSADGQQED
860 870 880 890 900
EASKIEALHK RRNLLAAFCK LIVYTVVEMN TAADIFKQYM KYYNDYGDII
910 920 930 940 950
KETMSKTRQI DKIQCAKTLI LSLQQLFNEM IQENGYNFDR SSSTFSGIKE
960 970 980 990 1000
LARRFALTFG LDQLKTREAI AMLHKDGIEF AFKEPNPQGE SHPPLNLAFL
1010 1020 1030 1040 1050
DILSEFSSKL LRQDKRTVYV YLEKFMTFQM SLRREDVWLP LMSYRNSLLA
1060 1070 1080 1090 1100
GGDDDTMSVI SGISSRGSTV RSKKSKPSTG KRKVVEGMQL SLTEESSSSD
1110 1120 1130 1140 1150
SMWLSREQTL HTPVMMQTPQ LTSTIMREPK RLRPEDSFMS VYPMQTEHHQ
1160 1170 1180 1190 1200
TPLDYNRRGT SLMEDDEEPI VEDVMMSSEG RIEDLNEGMD FDTMDIDLPP
1210 1220 1230
SKNRRERTEL KPDFFDPASI MDESVLGVSM F
Length:1,231
Mass (Da):141,326
Last modified:August 16, 2005 - v3
Checksum:i692358EFFFF61BB9
GO
Isoform 2 (identifier: Q8N3U4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1156-1156: N → NTQVTWMLAQRQQEEARQQQERAAMSYVKLRTNLQHAI

Show »
Length:1,268
Mass (Da):145,751
Checksum:i38F24736F06D9054
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AMT4B1AMT4_HUMAN
Cohesin subunit SA-2
STAG2
548Annotation score:
B1AMT1B1AMT1_HUMAN
Cohesin subunit SA-2
STAG2
154Annotation score:
B1AMT2B1AMT2_HUMAN
Cohesin subunit SA-2
STAG2
169Annotation score:
B1AMT0B1AMT0_HUMAN
Cohesin subunit SA-2
STAG2
115Annotation score:
B1AMS9B1AMS9_HUMAN
Cohesin subunit SA-2
STAG2
70Annotation score:
B1AMT3B1AMT3_HUMAN
Cohesin subunit SA-2
STAG2
207Annotation score:
E7ERE6E7ERE6_HUMAN
Cohesin subunit SA-2
STAG2
58Annotation score:
B1AMS8B1AMS8_HUMAN
Cohesin subunit SA-2
STAG2
40Annotation score:

Sequence cautioni

The sequence CAA99732 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46G → D in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti302A → R in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti327S → G in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti607 – 608KH → ND in CAA99732 (PubMed:9305759).Curated2
Sequence conflicti706W → R in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti710A → V in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti835I → T in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti971A → T in CAH18271 (PubMed:17974005).Curated1
Sequence conflicti992H → Y in CAD38591 (PubMed:17974005).Curated1
Sequence conflicti1105S → T in CAA99732 (PubMed:9305759).Curated1
Sequence conflicti1144M → K in CAA99732 (PubMed:9305759).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060114699N → K. Corresponds to variant dbSNP:rs6655782Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0411191156N → NTQVTWMLAQRQQEEARQQQ ERAAMSYVKLRTNLQHAI in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL831939 mRNA Translation: CAD38591.1
CR749433 mRNA Translation: CAH18271.1
AL355476 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11853.1
CH471107 Genomic DNA Translation: EAX11854.1
CH471107 Genomic DNA Translation: EAX11855.1
CH471107 Genomic DNA Translation: EAX11856.1
CH471107 Genomic DNA Translation: EAX11857.1
BC001765 mRNA Translation: AAH01765.2
Z75331 mRNA Translation: CAA99732.1 Different initiation.
CCDSiCCDS14607.1 [Q8N3U4-1]
CCDS43990.1 [Q8N3U4-2]
RefSeqiNP_001036214.1, NM_001042749.2 [Q8N3U4-2]
NP_001036215.1, NM_001042750.1 [Q8N3U4-2]
NP_001036216.1, NM_001042751.1 [Q8N3U4-1]
NP_001269347.1, NM_001282418.1 [Q8N3U4-1]
NP_006594.3, NM_006603.4 [Q8N3U4-1]
XP_005262414.1, XM_005262357.2 [Q8N3U4-2]
XP_005262415.1, XM_005262358.2 [Q8N3U4-2]
XP_005262416.1, XM_005262359.3 [Q8N3U4-2]
XP_005262417.1, XM_005262360.2 [Q8N3U4-2]
XP_005262418.1, XM_005262361.2 [Q8N3U4-1]
XP_006724790.1, XM_006724727.1 [Q8N3U4-2]
XP_011529555.1, XM_011531253.2 [Q8N3U4-2]
XP_016884721.1, XM_017029232.1 [Q8N3U4-1]
XP_016884722.1, XM_017029233.1 [Q8N3U4-1]
XP_016884723.1, XM_017029234.1 [Q8N3U4-1]
UniGeneiHs.496710
Hs.624663

Genome annotation databases

EnsembliENST00000218089; ENSP00000218089; ENSG00000101972 [Q8N3U4-2]
ENST00000371144; ENSP00000360186; ENSG00000101972 [Q8N3U4-1]
ENST00000371145; ENSP00000360187; ENSG00000101972 [Q8N3U4-2]
ENST00000371157; ENSP00000360199; ENSG00000101972 [Q8N3U4-1]
ENST00000371160; ENSP00000360202; ENSG00000101972 [Q8N3U4-1]
GeneIDi10735
KEGGihsa:10735
UCSCiuc004eua.5 human [Q8N3U4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL831939 mRNA Translation: CAD38591.1
CR749433 mRNA Translation: CAH18271.1
AL355476 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11853.1
CH471107 Genomic DNA Translation: EAX11854.1
CH471107 Genomic DNA Translation: EAX11855.1
CH471107 Genomic DNA Translation: EAX11856.1
CH471107 Genomic DNA Translation: EAX11857.1
BC001765 mRNA Translation: AAH01765.2
Z75331 mRNA Translation: CAA99732.1 Different initiation.
CCDSiCCDS14607.1 [Q8N3U4-1]
CCDS43990.1 [Q8N3U4-2]
RefSeqiNP_001036214.1, NM_001042749.2 [Q8N3U4-2]
NP_001036215.1, NM_001042750.1 [Q8N3U4-2]
NP_001036216.1, NM_001042751.1 [Q8N3U4-1]
NP_001269347.1, NM_001282418.1 [Q8N3U4-1]
NP_006594.3, NM_006603.4 [Q8N3U4-1]
XP_005262414.1, XM_005262357.2 [Q8N3U4-2]
XP_005262415.1, XM_005262358.2 [Q8N3U4-2]
XP_005262416.1, XM_005262359.3 [Q8N3U4-2]
XP_005262417.1, XM_005262360.2 [Q8N3U4-2]
XP_005262418.1, XM_005262361.2 [Q8N3U4-1]
XP_006724790.1, XM_006724727.1 [Q8N3U4-2]
XP_011529555.1, XM_011531253.2 [Q8N3U4-2]
XP_016884721.1, XM_017029232.1 [Q8N3U4-1]
XP_016884722.1, XM_017029233.1 [Q8N3U4-1]
XP_016884723.1, XM_017029234.1 [Q8N3U4-1]
UniGeneiHs.496710
Hs.624663

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PJUX-ray3.05A80-1060[»]
4PJWX-ray2.85A80-1060[»]
4PK7X-ray2.95A80-1060[»]
ProteinModelPortaliQ8N3U4
SMRiQ8N3U4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115958, 51 interactors
CORUMiQ8N3U4
DIPiDIP-35418N
IntActiQ8N3U4, 21 interactors
MINTiQ8N3U4
STRINGi9606.ENSP00000218089

PTM databases

iPTMnetiQ8N3U4
PhosphoSitePlusiQ8N3U4

Polymorphism and mutation databases

BioMutaiSTAG2
DMDMi73621291

Proteomic databases

EPDiQ8N3U4
MaxQBiQ8N3U4
PaxDbiQ8N3U4
PeptideAtlasiQ8N3U4
PRIDEiQ8N3U4
ProteomicsDBi71836
71837 [Q8N3U4-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000218089; ENSP00000218089; ENSG00000101972 [Q8N3U4-2]
ENST00000371144; ENSP00000360186; ENSG00000101972 [Q8N3U4-1]
ENST00000371145; ENSP00000360187; ENSG00000101972 [Q8N3U4-2]
ENST00000371157; ENSP00000360199; ENSG00000101972 [Q8N3U4-1]
ENST00000371160; ENSP00000360202; ENSG00000101972 [Q8N3U4-1]
GeneIDi10735
KEGGihsa:10735
UCSCiuc004eua.5 human [Q8N3U4-1]

Organism-specific databases

CTDi10735
DisGeNETi10735
EuPathDBiHostDB:ENSG00000101972.18
GeneCardsiSTAG2
HGNCiHGNC:11355 STAG2
HPAiHPA002857
MIMi300826 gene
neXtProtiNX_Q8N3U4
OpenTargetsiENSG00000101972
PharmGKBiPA36177
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2011 Eukaryota
COG5537 LUCA
GeneTreeiENSGT00390000014094
HOVERGENiHBG057636
InParanoidiQ8N3U4
KOiK06671
OMAiICDLLII
OrthoDBiEOG091G0195
PhylomeDBiQ8N3U4
TreeFamiTF314604

Enzyme and pathway databases

ReactomeiR-HSA-1221632 Meiotic synapsis
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2468052 Establishment of Sister Chromatid Cohesion
R-HSA-2470946 Cohesin Loading onto Chromatin
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-9018519 Estrogen-dependent gene expression
SIGNORiQ8N3U4

Miscellaneous databases

ChiTaRSiSTAG2 human
GeneWikiiSTAG2
GenomeRNAii10735
PROiPR:Q8N3U4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101972 Expressed in 246 organ(s), highest expression level in mucosa of paranasal sinus
CleanExiHS_STAG2
ExpressionAtlasiQ8N3U4 baseline and differential
GenevisibleiQ8N3U4 HS

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR039662 Cohesin_Scc3/SA
IPR020839 SCD
IPR013721 STAG
PANTHERiPTHR11199 PTHR11199, 1 hit
PfamiView protein in Pfam
PF08514 STAG, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51425 SCD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTAG2_HUMAN
AccessioniPrimary (citable) accession number: Q8N3U4
Secondary accession number(s): B1AMT5
, D3DTF5, O00540, Q5JTI6, Q68DE9, Q9H1N8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: August 16, 2005
Last modified: November 7, 2018
This is version 160 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again