Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Maturin

Gene

MTURN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in early neuronal development.By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Maturin
Alternative name(s):
Maturin neural progenitor differentiation regulator protein homolog
Protein Ells1
Gene namesi
Name:MTURN
Synonyms:C7orf41
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000180354.15
HGNCiHGNC:25457 MTURN
neXtProtiNX_Q8N3F0

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180354
PharmGKBiPA147358571

Polymorphism and mutation databases

BioMutaiC7orf41
DMDMi74714835

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002942331 – 131MaturinAdd BLAST131

Proteomic databases

EPDiQ8N3F0
MaxQBiQ8N3F0
PaxDbiQ8N3F0
PeptideAtlasiQ8N3F0
PRIDEiQ8N3F0
ProteomicsDBi71795
71796 [Q8N3F0-2]
71797 [Q8N3F0-3]

PTM databases

iPTMnetiQ8N3F0
PhosphoSitePlusiQ8N3F0

Expressioni

Gene expression databases

BgeeiENSG00000180354
CleanExiHS_C7orf41
ExpressionAtlasiQ8N3F0 baseline and differential
GenevisibleiQ8N3F0 HS

Organism-specific databases

HPAiHPA029507

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DAZAP2Q150384EBI-11980301,EBI-724310

Protein-protein interaction databases

BioGridi128785, 2 interactors
IntActiQ8N3F0, 21 interactors

Structurei

3D structure databases

ProteinModelPortaliQ8N3F0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi115 – 120Poly-Glu6

Sequence similaritiesi

Belongs to the MTURN family.Curated

Phylogenomic databases

eggNOGiENOG410IVXX Eukaryota
ENOG4111H1K LUCA
GeneTreeiENSGT00500000045044
HOGENOMiHOG000069946
HOVERGENiHBG107664
InParanoidiQ8N3F0
OMAiDKWCSNT
OrthoDBiEOG091G14J1
PhylomeDBiQ8N3F0
TreeFamiTF332814

Family and domain databases

InterProiView protein in InterPro
IPR027892 DUF4581
PANTHERiPTHR32008 PTHR32008, 1 hit
PfamiView protein in Pfam
PF15167 DUF4581, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N3F0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDFQQLADVA EKWCSNTPFE LIATEETERR MDFYADPGVS FYVLCPDNGC
60 70 80 90 100
GDNFHVWSES EDCLPFLQLA QDYISSCGKK TLHEVLEKVF KSFRPLLGLP
110 120 130
DADDDAFEEY SADVEEEEPE ADHPQMGVSQ Q
Length:131
Mass (Da):14,925
Last modified:September 13, 2004 - v2
Checksum:iBD60297F085B5C59
GO
Isoform 2 (identifier: Q8N3F0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-131: PLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ → GLISAVHALPVETWLFFVLWQTGALEVVYV

Note: No experimental confirmation available.
Show »
Length:124
Mass (Da):14,210
Checksum:i3B6E4F858C4ADE6B
GO
Isoform 3 (identifier: Q8N3F0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNF → MATHCPLYCVGADLMMNRAGE

Note: No experimental confirmation available.
Show »
Length:98
Mass (Da):11,021
Checksum:i57FD332B2474E7E1
GO
Isoform 4 (identifier: Q8N3F0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-95: Missing.

Note: No experimental confirmation available.
Show »
Length:90
Mass (Da):10,147
Checksum:iCC401B373E028696
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti82L → P in BAC04811 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0266081 – 54MDFQQ…CGDNF → MATHCPLYCVGADLMMNRAG E in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_05352555 – 95Missing in isoform 4. CuratedAdd BLAST41
Alternative sequenceiVSP_02660995 – 131PLLGL…GVSQQ → GLISAVHALPVETWLFFVLW QTGALEVVYV in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY054121 mRNA Translation: AAL14866.1
AK096533 mRNA Translation: BAC04811.1
AK098769 mRNA Translation: BAC05408.1
AL834391 mRNA Translation: CAD39053.2
AC007036 Genomic DNA No translation available.
CCDSiCCDS5425.2 [Q8N3F0-1]
RefSeqiNP_690006.2, NM_152793.2 [Q8N3F0-1]
XP_005249709.1, XM_005249652.3 [Q8N3F0-1]
UniGeneiHs.200100

Genome annotation databases

EnsembliENST00000324453; ENSP00000324204; ENSG00000180354 [Q8N3F0-1]
ENST00000324489; ENSP00000324755; ENSG00000180354 [Q8N3F0-3]
ENST00000409688; ENSP00000386490; ENSG00000180354 [Q8N3F0-4]
GeneIDi222166
KEGGihsa:222166
UCSCiuc003tar.2 human [Q8N3F0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMTURN_HUMAN
AccessioniPrimary (citable) accession number: Q8N3F0
Secondary accession number(s): B8ZZW9
, Q8N791, Q8N8M4, Q8NEX2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: September 13, 2004
Last modified: July 18, 2018
This is version 100 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health