Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (16 Oct 2019)
Sequence version 3 (11 Sep 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Activating signal cointegrator 1 complex subunit 3

Gene

ASCC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions (PubMed:22055184). Part of the ASC-1 complex that enhances NF-kappa-B, SRF and AP1 transactivation (PubMed:12077347).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi499 – 506ATPPROSITE-ProRule annotation8
Nucleotide bindingi1349 – 1356ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHelicase, Hydrolase
Biological processDNA damage, DNA repair, Transcription, Transcription regulation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112126 ALKBH3 mediated reversal of alkylation damage

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 3 (EC:3.6.4.121 Publication)
Alternative name(s):
ASC-1 complex subunit p2001 Publication
Short name:
ASC1p200
Helicase, ATP binding 1
Trip4 complex subunit p2001 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASCC3
Synonyms:HELIC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18697 ASCC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614217 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N3C0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1354G → D: Abolishes 3'-5' DNA helicase activity and ability to promote DNA repair. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10973

Open Targets

More...
OpenTargetsi
ENSG00000112249

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134890913

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N3C0

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ASCC3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158518649

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001020931 – 2202Activating signal cointegrator 1 complex subunit 3Add BLAST2202

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12PhosphoserineCombined sources1
Modified residuei572N6-acetyllysineCombined sources1
Modified residuei2195PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N3C0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N3C0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N3C0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N3C0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N3C0

PeptideAtlas

More...
PeptideAtlasi
Q8N3C0

PRoteomics IDEntifications database

More...
PRIDEi
Q8N3C0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71786 [Q8N3C0-1]
71787 [Q8N3C0-3]
71788 [Q8N3C0-4]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q8N3C0

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N3C0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N3C0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000112249 Expressed in 213 organ(s), highest expression level in decidua

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N3C0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N3C0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031608
HPA031609
HPA031610

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in the ASCC complex that contains ASCC1, ASCC2 and ASCC3 (PubMed:12077347, PubMed:29144457, PubMed:29997253). Functions as scaffolding subunit that interacts directly with both ASCC1 and ASCC2 (PubMed:29144457, PubMed:29997253).

Interacts directly with ALKBH3, and thereby recruits ALKBH3 to the ASCC complex (PubMed:22055184, PubMed:29144457). Part of the ASC-1/TRIP4 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3 (PubMed:12077347).

4 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116170, 75 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8N3C0

Protein interaction database and analysis system

More...
IntActi
Q8N3C0, 31 interactors

Molecular INTeraction database

More...
MINTi
Q8N3C0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000358159

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N3C0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini486 – 669Helicase ATP-binding 1PROSITE-ProRule annotationAdd BLAST184
Domaini728 – 914Helicase C-terminal 1PROSITE-ProRule annotationAdd BLAST187
Domaini978 – 1287SEC63 1Add BLAST310
Domaini1336 – 1511Helicase ATP-binding 2PROSITE-ProRule annotationAdd BLAST176
Domaini1544 – 1739Helicase C-terminal 2PROSITE-ProRule annotationAdd BLAST196
Domaini1812 – 2176SEC63 2Add BLAST365

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 400Required for interaction with ASCC21 PublicationAdd BLAST400

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili18 – 79Sequence analysisAdd BLAST62
Coiled coili328 – 356Sequence analysisAdd BLAST29

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi611 – 614DEVH box4
Motifi1453 – 1456DEIH box4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the helicase family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0952 Eukaryota
COG1204 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155377

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000152625

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N3C0

KEGG Orthology (KO)

More...
KOi
K18663

Identification of Orthologs from Complete Genome Data

More...
OMAi
YKTLNRM

Database of Orthologous Groups

More...
OrthoDBi
154891at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N3C0

TreeFam database of animal gene trees

More...
TreeFami
TF105778

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR035892 C2_domain_sf
IPR011545 DEAD/DEAH_box_helicase_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR014756 Ig_E-set
IPR027417 P-loop_NTPase
IPR004179 Sec63-dom
IPR036390 WH_DNA-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00270 DEAD, 2 hits
PF00271 Helicase_C, 2 hits
PF02889 Sec63, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 2 hits
SM00487 DEXDc, 2 hits
SM00490 HELICc, 2 hits
SM00973 Sec63, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 2 hits
SSF52540 SSF52540, 4 hits
SSF81296 SSF81296, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51192 HELICASE_ATP_BIND_1, 2 hits
PS51194 HELICASE_CTER, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N3C0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALPRLTGAL RSFSNVTKQD NYNEEVADLK IKRSKLHEQV LDLGLTWKKI
60 70 80 90 100
IKFLNEKLEK SKMQSINEDL KDILHAAKQI VGTDNGREAI ESGAAFLFMT
110 120 130 140 150
FHLKDSVGHK ETKAIKQMFG PFPSSSATAA CNATNRIISH FSQDDLTALV
160 170 180 190 200
QMTEKEHGDR VFFGKNLAFS FDMHDLDHFD ELPINGETQK TISLDYKKFL
210 220 230 240 250
NEHLQEACTP ELKPVEKTNG SFLWCEVEKY LNSTLKEMTE VPRVEDLCCT
260 270 280 290 300
LYDMLASIKS GDELQDELFE LLGPEGLELI EKLLQNRITI VDRFLNSSND
310 320 330 340 350
HRFQALQDNC KKILGENAKP NYGCQVTIQS EQEKQLMKQY RREEKRIARR
360 370 380 390 400
EKKAGEDLEV SEGLMCFDPK ELRIQREQAL LNARSVPILS RQRDADVEKI
410 420 430 440 450
HYPHVYDSQA EAMKTSAFIA GAKMILPEGI QRENNKLYEE VRIPYSEPMP
460 470 480 490 500
LSFEEKPVYI QDLDEIGQLA FKGMKRLNRI QSIVFETAYN TNENMLICAP
510 520 530 540 550
TGAGKTNIAM LTVLHEIRQH FQQGVIKKNE FKIVYVAPMK ALAAEMTDYF
560 570 580 590 600
SRRLEPLGII VKELTGDMQL SKSEILRTQM LVTTPEKWDV VTRKSVGDVA
610 620 630 640 650
LSQIVRLLIL DEVHLLHEDR GPVLESIVAR TLRQVESTQS MIRILGLSAT
660 670 680 690 700
LPNYLDVATF LHVNPYIGLF FFDGRFRPVP LGQTFLGIKC ANKMQQLNNM
710 720 730 740 750
DEVCYENVLK QVKAGHQVMV FVHARNATVR TAMSLIERAK NCGHIPFFFP
760 770 780 790 800
TQGHDYVLAE KQVQRSRNKQ VRELFPDGFS IHHAGMLRQD RNLVENLFSN
810 820 830 840 850
GHIKVLVCTA TLAWGVNLPA HAVIIKGTQI YAAKRGSFVD LGILDVMQIF
860 870 880 890 900
GRAGRPQFDK FGEGIIITTH DKLSHYLTLL TQRNPIESQF LESLADNLNA
910 920 930 940 950
EIALGTVTNV EEAVKWISYT YLYVRMRANP LAYGISHKAY QIDPTLRKHR
960 970 980 990 1000
EQLVIEVGRK LDKAQMIRFE ERTGYFSSTD LGRTASHYYI KYNTIETFNE
1010 1020 1030 1040 1050
LFDAHKTEGD IFAIVSKAEE FDQIKVREEE IEELDTLLSN FCELSTPGGV
1060 1070 1080 1090 1100
ENSYGKINIL LQTYISRGEM DSFSLISDSA YVAQNAARIV RALFEIALRK
1110 1120 1130 1140 1150
RWPTMTYRLL NLSKVIDKRL WGWASPLRQF SILPPHILTR LEEKKLTVDK
1160 1170 1180 1190 1200
LKDMRKDEIG HILHHVNIGL KVKQCVHQIP SVMMEASIQP ITRTVLRVTL
1210 1220 1230 1240 1250
SIYADFTWND QVHGTVGEPW WIWVEDPTND HIYHSEYFLA LKKQVISKEA
1260 1270 1280 1290 1300
QLLVFTIPIF EPLPSQYYIR AVSDRWLGAE AVCIINFQHL ILPERHPPHT
1310 1320 1330 1340 1350
ELLDLQPLPI TALGCKAYEA LYNFSHFNPV QTQIFHTLYH TDCNVLLGAP
1360 1370 1380 1390 1400
TGSGKTVAAE LAIFRVFNKY PTSKAVYIAP LKALVRERMD DWKVRIEEKL
1410 1420 1430 1440 1450
GKKVIELTGD VTPDMKSIAK ADLIVTTPEK WDGVSRSWQN RNYVQQVTIL
1460 1470 1480 1490 1500
IIDEIHLLGE ERGPVLEVIV SRTNFISSHT EKPVRIVGLS TALANARDLA
1510 1520 1530 1540 1550
DWLNIKQMGL FNFRPSVRPV PLEVHIQGFP GQHYCPRMAS MNKPAFQAIR
1560 1570 1580 1590 1600
SHSPAKPVLI FVSSRRQTRL TALELIAFLA TEEDPKQWLN MDEREMENII
1610 1620 1630 1640 1650
ATVRDSNLKL TLAFGIGMHH AGLHERDRKT VEELFVNCKV QVLIATSTLA
1660 1670 1680 1690 1700
WGVNFPAHLV IIKGTEYYDG KTRRYVDFPI TDVLQMMGRA GRPQFDDQGK
1710 1720 1730 1740 1750
AVILVHDIKK DFYKKFLYEP FPVESSLLGV LSDHLNAEIA GGTITSKQDA
1760 1770 1780 1790 1800
LDYITWTYFF RRLIMNPSYY NLGDVSHDSV NKFLSHLIEK SLIELELSYC
1810 1820 1830 1840 1850
IEIGEDNRSI EPLTYGRIAS YYYLKHQTVK MFKDRLKPEC STEELLSILS
1860 1870 1880 1890 1900
DAEEYTDLPV RHNEDHMNSE LAKCLPIESN PHSFDSPHTK AHLLLQAHLS
1910 1920 1930 1940 1950
RAMLPCPDYD TDTKTVLDQA LRVCQAMLDV AANQGWLVTV LNITNLIQMV
1960 1970 1980 1990 2000
IQGRWLKDSS LLTLPNIENH HLHLFKKWKP IMKGPHARGR TSIESLPELI
2010 2020 2030 2040 2050
HACGGKDHVF SSMVESELHA AKTKQAWNFL SHLPVINVGI SVKGSWDDLV
2060 2070 2080 2090 2100
EGHNELSVST LTADKRDDNK WIKLHADQEY VLQVSLQRVH FGFHKGKPES
2110 2120 2130 2140 2150
CAVTPRFPKS KDEGWFLILG EVDKRELIAL KRVGYIRNHH VASLSFYTPE
2160 2170 2180 2190 2200
IPGRYIYTLY FMSDCYLGLD QQYDIYLNVT QASLSAQVNT KVSDSLTDLA

LK
Length:2,202
Mass (Da):251,460
Last modified:September 11, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9F074E6E5853399C
GO
Isoform 2 (identifier: Q8N3C0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-111: VGTDNGREAIESGAAFLFMTFHLKDSVGHKE → EVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
     112-2202: Missing.

Show »
Length:111
Mass (Da):13,014
Checksum:iF3D84693464682F3
GO
Isoform 3 (identifier: Q8N3C0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     719-731: MVFVHARNATVRT → HLFYLLLHLFICF
     732-2202: Missing.

Show »
Length:731
Mass (Da):83,675
Checksum:iE82CDB32BEC21AF3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RFZ0E5RFZ0_HUMAN
Activating signal cointegrator 1 co...
ASCC3
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KNJ4J3KNJ4_HUMAN
Activating signal cointegrator 1 co...
ASCC3
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG45474 differs from that shown. Reason: Frameshift.Curated
The sequence CAA11679 differs from that shown. Reason: Frameshift.Curated
The sequence CAA11679 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti86G → E in AAH26066 (PubMed:15489334).Curated1
Sequence conflicti444P → S in CAD39122 (PubMed:17974005).Curated1
Sequence conflicti582V → A in AAH26066 (PubMed:15489334).Curated1
Sequence conflicti750P → S in CAD39122 (PubMed:17974005).Curated1
Sequence conflicti1187S → F in CAA11679 (Ref. 7) Curated1
Sequence conflicti1343C → S in CAA11679 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034859146L → F1 PublicationCorresponds to variant dbSNP:rs9390698Ensembl.1
Natural variantiVAR_049339344E → K. Corresponds to variant dbSNP:rs6918004Ensembl.1
Natural variantiVAR_049340478N → S. Corresponds to variant dbSNP:rs7750940Ensembl.1
Natural variantiVAR_0612121016S → C. Corresponds to variant dbSNP:rs57534235Ensembl.1
Natural variantiVAR_0348601050V → I. Corresponds to variant dbSNP:rs9497983Ensembl.1
Natural variantiVAR_0493411425V → A. Corresponds to variant dbSNP:rs17246013Ensembl.1
Natural variantiVAR_0493421497R → T. Corresponds to variant dbSNP:rs17305382Ensembl.1
Natural variantiVAR_0348611800C → W. Corresponds to variant dbSNP:rs35011147Ensembl.1
Natural variantiVAR_0348621930V → M. Corresponds to variant dbSNP:rs3213542Ensembl.1
Natural variantiVAR_0348631995S → C2 PublicationsCorresponds to variant dbSNP:rs240780Ensembl.1
Natural variantiVAR_0348642176Y → C. Corresponds to variant dbSNP:rs240768Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04295581 – 111VGTDN…VGHKE → EVNCPFQKRRLDGKEEDEKM SRASDRFRGLR in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_042956112 – 2202Missing in isoform 2. 2 PublicationsAdd BLAST2091
Alternative sequenceiVSP_042957719 – 731MVFVH…ATVRT → HLFYLLLHLFICF in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_042958732 – 2202Missing in isoform 3. 1 PublicationAdd BLAST1471

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL834463 mRNA Translation: CAD39122.1
AK315197 mRNA Translation: BAG37637.1
AL121965 Genomic DNA No translation available.
AL133338 Genomic DNA No translation available.
AL356122 Genomic DNA No translation available.
AL591585 Genomic DNA No translation available.
Z86062 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48449.1
BC050681 mRNA Translation: AAH50681.1
BC125211 mRNA Translation: AAI25212.1
BC125212 mRNA Translation: AAI25213.1
BC026066 mRNA Translation: AAH26066.1
AY013288 mRNA Translation: AAG45474.1 Frameshift.
AJ223948 mRNA Translation: CAA11679.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5046.1 [Q8N3C0-1]
CCDS5047.1 [Q8N3C0-3]
CCDS75497.1 [Q8N3C0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001271200.1, NM_001284271.1 [Q8N3C0-4]
NP_006819.2, NM_006828.3 [Q8N3C0-1]
NP_071374.1, NM_022091.4 [Q8N3C0-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000369143; ENSP00000358139; ENSG00000112249 [Q8N3C0-3]
ENST00000369162; ENSP00000358159; ENSG00000112249 [Q8N3C0-1]
ENST00000522650; ENSP00000430769; ENSG00000112249 [Q8N3C0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10973

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10973

UCSC genome browser

More...
UCSCi
uc003pqk.5 human [Q8N3C0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL834463 mRNA Translation: CAD39122.1
AK315197 mRNA Translation: BAG37637.1
AL121965 Genomic DNA No translation available.
AL133338 Genomic DNA No translation available.
AL356122 Genomic DNA No translation available.
AL591585 Genomic DNA No translation available.
Z86062 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48449.1
BC050681 mRNA Translation: AAH50681.1
BC125211 mRNA Translation: AAI25212.1
BC125212 mRNA Translation: AAI25213.1
BC026066 mRNA Translation: AAH26066.1
AY013288 mRNA Translation: AAG45474.1 Frameshift.
AJ223948 mRNA Translation: CAA11679.1 Sequence problems.
CCDSiCCDS5046.1 [Q8N3C0-1]
CCDS5047.1 [Q8N3C0-3]
CCDS75497.1 [Q8N3C0-4]
RefSeqiNP_001271200.1, NM_001284271.1 [Q8N3C0-4]
NP_006819.2, NM_006828.3 [Q8N3C0-1]
NP_071374.1, NM_022091.4 [Q8N3C0-3]

3D structure databases

SMRiQ8N3C0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116170, 75 interactors
CORUMiQ8N3C0
IntActiQ8N3C0, 31 interactors
MINTiQ8N3C0
STRINGi9606.ENSP00000358159

PTM databases

CarbonylDBiQ8N3C0
iPTMnetiQ8N3C0
PhosphoSitePlusiQ8N3C0

Polymorphism and mutation databases

BioMutaiASCC3
DMDMi158518649

Proteomic databases

EPDiQ8N3C0
jPOSTiQ8N3C0
MassIVEiQ8N3C0
MaxQBiQ8N3C0
PaxDbiQ8N3C0
PeptideAtlasiQ8N3C0
PRIDEiQ8N3C0
ProteomicsDBi71786 [Q8N3C0-1]
71787 [Q8N3C0-3]
71788 [Q8N3C0-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10973

Genome annotation databases

EnsembliENST00000369143; ENSP00000358139; ENSG00000112249 [Q8N3C0-3]
ENST00000369162; ENSP00000358159; ENSG00000112249 [Q8N3C0-1]
ENST00000522650; ENSP00000430769; ENSG00000112249 [Q8N3C0-4]
GeneIDi10973
KEGGihsa:10973
UCSCiuc003pqk.5 human [Q8N3C0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10973
DisGeNETi10973

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ASCC3
HGNCiHGNC:18697 ASCC3
HPAiHPA031608
HPA031609
HPA031610
MIMi614217 gene
neXtProtiNX_Q8N3C0
OpenTargetsiENSG00000112249
PharmGKBiPA134890913

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0952 Eukaryota
COG1204 LUCA
GeneTreeiENSGT00940000155377
HOGENOMiHOG000152625
InParanoidiQ8N3C0
KOiK18663
OMAiYKTLNRM
OrthoDBi154891at2759
PhylomeDBiQ8N3C0
TreeFamiTF105778

Enzyme and pathway databases

ReactomeiR-HSA-112126 ALKBH3 mediated reversal of alkylation damage

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ASCC3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ASCC3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10973
PharosiQ8N3C0

Protein Ontology

More...
PROi
PR:Q8N3C0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000112249 Expressed in 213 organ(s), highest expression level in decidua
ExpressionAtlasiQ8N3C0 baseline and differential
GenevisibleiQ8N3C0 HS

Family and domain databases

Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR035892 C2_domain_sf
IPR011545 DEAD/DEAH_box_helicase_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR014756 Ig_E-set
IPR027417 P-loop_NTPase
IPR004179 Sec63-dom
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF00270 DEAD, 2 hits
PF00271 Helicase_C, 2 hits
PF02889 Sec63, 2 hits
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SM00487 DEXDc, 2 hits
SM00490 HELICc, 2 hits
SM00973 Sec63, 2 hits
SUPFAMiSSF46785 SSF46785, 2 hits
SSF52540 SSF52540, 4 hits
SSF81296 SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS51192 HELICASE_ATP_BIND_1, 2 hits
PS51194 HELICASE_CTER, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASCC3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N3C0
Secondary accession number(s): E7EW23
, O43738, Q4G1A0, Q5VTN2, Q9H1I9, Q9H5A2, Q9NTR0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: September 11, 2007
Last modified: October 16, 2019
This is version 169 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again