Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-conjugating enzyme E2 J2

Gene

UBE2J2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD).PROSITE-ProRule annotation

Catalytic activityi

S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.PROSITE-ProRule annotation

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.PROSITE-ProRule annotation
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei94Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ubiquitin conjugating enzyme activity Source: MGI
  • ubiquitin protein ligase binding Source: ParkinsonsUK-UCL

GO - Biological processi

  • positive regulation of protein targeting to mitochondrion Source: ParkinsonsUK-UCL
  • protein polyubiquitination Source: GO_Central
  • protein ubiquitination Source: Reactome
  • response to unfolded protein Source: UniProtKB-KW
  • ubiquitin-dependent ERAD pathway Source: ParkinsonsUK-UCL

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway, Unfolded protein response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ8N2K1
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 J2 (EC:2.3.2.23)
Alternative name(s):
E2 ubiquitin-conjugating enzyme J2
Non-canonical ubiquitin-conjugating enzyme 2
Short name:
NCUBE-2
Gene namesi
Name:UBE2J2
Synonyms:NCUBE2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000160087.20
HGNCiHGNC:19268 UBE2J2
neXtProtiNX_Q8N2K1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 226CytoplasmicSequence analysisAdd BLAST226
Transmembranei227 – 247Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini248 – 259LumenalSequence analysisAdd BLAST12

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134882268

Polymorphism and mutation databases

BioMutaiUBE2J2
DMDMi251757431

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000825961 – 259Ubiquitin-conjugating enzyme E2 J2Add BLAST259

Post-translational modificationi

Auto-ubiquitinated.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8N2K1
MaxQBiQ8N2K1
PeptideAtlasiQ8N2K1
PRIDEiQ8N2K1
ProteomicsDBi71714
71715 [Q8N2K1-2]

PTM databases

iPTMnetiQ8N2K1
PhosphoSitePlusiQ8N2K1

Expressioni

Gene expression databases

BgeeiENSG00000160087 Expressed in 202 organ(s), highest expression level in testis
CleanExiHS_UBE2J2
ExpressionAtlasiQ8N2K1 baseline and differential
GenevisibleiQ8N2K1 HS

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi125598, 18 interactors
IntActiQ8N2K1, 9 interactors

Structurei

Secondary structure

1259
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8N2K1
SMRiQ8N2K1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N2K1

Family & Domainsi

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00530000063379
HOGENOMiHOG000170330
HOVERGENiHBG058434
InParanoidiQ8N2K1
KOiK04554
OMAiFQPPSIY
OrthoDBiEOG091G0IUT
PhylomeDBiQ8N2K1
TreeFamiTF101123

Family and domain databases

CDDicd00195 UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N2K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSTSSKRAP TTATQRLKQD YLRIKKDPVP YICAEPLPSN ILEWHYVVRG
60 70 80 90 100
PEMTPYEGGY YHGKLIFPRE FPFKPPSIYM ITPNGRFKCN TRLCLSITDF
110 120 130 140 150
HPDTWNPAWS VSTILTGLLS FMVEKGPTLG SIETSDFTKR QLAVQSLAFN
160 170 180 190 200
LKDKVFCELF PEVVEEIKQK QKAQDELSSR PQTLPLPDVV PDGETHLVQN
210 220 230 240 250
GIQLLNGHAP GAVPNLAGLQ QANRHHGLLG GALANLFVIV GFAAFAYTVK

YVLRSIAQE
Length:259
Mass (Da):28,898
Last modified:July 7, 2009 - v3
Checksum:i7DB5280D2947CE7E
GO
Isoform 2 (identifier: Q8N2K1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEW → MWPQDIAGR

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):24,937
Checksum:iD5E649B09D7CC30E
GO
Isoform 3 (identifier: Q8N2K1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-44: W → WFKRFSWLSLLSSWDYR

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):30,972
Checksum:i602B2575ABC79E4E
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NGS0A6NGS0_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2 hCG_20420
207Annotation score:
B1AMF0B1AMF0_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
196Annotation score:
B1AMF1B1AMF1_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
101Annotation score:
D6RA15D6RA15_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
100Annotation score:
D6RB84D6RB84_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
71Annotation score:
D6RC43D6RC43_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
105Annotation score:
D6REN4D6REN4_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
43Annotation score:
D6RD90D6RD90_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
60Annotation score:
D6R9H0D6R9H0_HUMAN
Ubiquitin-conjugating enzyme E2 J2
UBE2J2
44Annotation score:

Sequence cautioni

The sequence BM544827 differs from that shown.Curated
The sequence BM544827 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2S → N in BAC11355 (PubMed:14702039).Curated1
Sequence conflicti100F → S in BAC11355 (PubMed:14702039).Curated1
Sequence conflicti214 – 238PNLAG…ANLFV → QTSQGSSRPTGTTDSGWRPG ELVC in AAK52609 (PubMed:11278356).CuratedAdd BLAST25

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0115721 – 44MSSTS…NILEW → MWPQDIAGR in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_04521944W → WFKRFSWLSLLSSWDYR in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA Translation: AAK52609.1
AK056065 mRNA Translation: BAB71086.1
AK075017 mRNA Translation: BAC11355.1
AK291935 mRNA Translation: BAF84624.1
AL162741 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56256.1
CH471183 Genomic DNA Translation: EAW56259.1
BC094777 mRNA Translation: AAH94777.1
BC104890 mRNA Translation: AAI04891.1
BC113430 mRNA Translation: AAI13431.1
BC143657 mRNA Translation: AAI43658.1
BM544827 mRNA No translation available.
CCDSiCCDS14.1 [Q8N2K1-1]
CCDS15.1 [Q8N2K1-3]
RefSeqiNP_477515.2, NM_058167.2 [Q8N2K1-1]
NP_919296.1, NM_194315.1 [Q8N2K1-3]
NP_919440.1, NM_194458.1
XP_005244775.1, XM_005244718.3 [Q8N2K1-1]
XP_005244776.1, XM_005244719.4 [Q8N2K1-1]
XP_006710396.1, XM_006710333.3 [Q8N2K1-1]
XP_011538915.1, XM_011540613.2 [Q8N2K1-2]
XP_011538916.1, XM_011540614.2 [Q8N2K1-1]
UniGeneiHs.191987

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087 [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087 [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087 [Q8N2K1-3]
GeneIDi118424
KEGGihsa:118424
UCSCiuc001ado.4 human [Q8N2K1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF296658 mRNA Translation: AAK52609.1
AK056065 mRNA Translation: BAB71086.1
AK075017 mRNA Translation: BAC11355.1
AK291935 mRNA Translation: BAF84624.1
AL162741 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56256.1
CH471183 Genomic DNA Translation: EAW56259.1
BC094777 mRNA Translation: AAH94777.1
BC104890 mRNA Translation: AAI04891.1
BC113430 mRNA Translation: AAI13431.1
BC143657 mRNA Translation: AAI43658.1
BM544827 mRNA No translation available.
CCDSiCCDS14.1 [Q8N2K1-1]
CCDS15.1 [Q8N2K1-3]
RefSeqiNP_477515.2, NM_058167.2 [Q8N2K1-1]
NP_919296.1, NM_194315.1 [Q8N2K1-3]
NP_919440.1, NM_194458.1
XP_005244775.1, XM_005244718.3 [Q8N2K1-1]
XP_005244776.1, XM_005244719.4 [Q8N2K1-1]
XP_006710396.1, XM_006710333.3 [Q8N2K1-1]
XP_011538915.1, XM_011540613.2 [Q8N2K1-2]
XP_011538916.1, XM_011540614.2 [Q8N2K1-1]
UniGeneiHs.191987

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F4WX-ray2.00A/B1-185[»]
ProteinModelPortaliQ8N2K1
SMRiQ8N2K1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125598, 18 interactors
IntActiQ8N2K1, 9 interactors

PTM databases

iPTMnetiQ8N2K1
PhosphoSitePlusiQ8N2K1

Polymorphism and mutation databases

BioMutaiUBE2J2
DMDMi251757431

Proteomic databases

EPDiQ8N2K1
MaxQBiQ8N2K1
PeptideAtlasiQ8N2K1
PRIDEiQ8N2K1
ProteomicsDBi71714
71715 [Q8N2K1-2]

Protocols and materials databases

DNASUi118424
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000349431; ENSP00000305826; ENSG00000160087 [Q8N2K1-1]
ENST00000360466; ENSP00000353653; ENSG00000160087 [Q8N2K1-1]
ENST00000400930; ENSP00000383719; ENSG00000160087 [Q8N2K1-3]
GeneIDi118424
KEGGihsa:118424
UCSCiuc001ado.4 human [Q8N2K1-1]

Organism-specific databases

CTDi118424
EuPathDBiHostDB:ENSG00000160087.20
GeneCardsiUBE2J2
H-InvDBiHIX0000017
HGNCiHGNC:19268 UBE2J2
neXtProtiNX_Q8N2K1
PharmGKBiPA134882268
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063379
HOGENOMiHOG000170330
HOVERGENiHBG058434
InParanoidiQ8N2K1
KOiK04554
OMAiFQPPSIY
OrthoDBiEOG091G0IUT
PhylomeDBiQ8N2K1
TreeFamiTF101123

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ8N2K1

Miscellaneous databases

ChiTaRSiUBE2J2 human
EvolutionaryTraceiQ8N2K1
GenomeRNAii118424
PROiPR:Q8N2K1

Gene expression databases

BgeeiENSG00000160087 Expressed in 202 organ(s), highest expression level in testis
CleanExiHS_UBE2J2
ExpressionAtlasiQ8N2K1 baseline and differential
GenevisibleiQ8N2K1 HS

Family and domain databases

CDDicd00195 UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUB2J2_HUMAN
AccessioniPrimary (citable) accession number: Q8N2K1
Secondary accession number(s): A8MYC7
, Q504T9, Q96N26, Q96T84
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: July 7, 2009
Last modified: November 7, 2018
This is version 146 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again