Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase 40

Gene

STK40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei66ATPPROSITE-ProRule annotation1
Active sitei196Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi41 – 49ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ8N2I9

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase 40 (EC:2.7.11.1)
Alternative name(s):
SINK-homologous serine/threonine-protein kinase
Sugen kinase 495
Short name:
SgK495
Gene namesi
Name:STK40
Synonyms:SGK495, SHIK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000196182.10
HGNCiHGNC:21373 STK40
MIMi609437 gene
neXtProtiNX_Q8N2I9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi83931
OpenTargetsiENSG00000196182
PharmGKBiPA142670860

Polymorphism and mutation databases

BioMutaiSTK40
DMDMi116256080

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002522611 – 435Serine/threonine-protein kinase 40Add BLAST435

Proteomic databases

MaxQBiQ8N2I9
PaxDbiQ8N2I9
PeptideAtlasiQ8N2I9
PRIDEiQ8N2I9
ProteomicsDBi71707
71708 [Q8N2I9-2]
71709 [Q8N2I9-3]
71710 [Q8N2I9-4]

PTM databases

iPTMnetiQ8N2I9
PhosphoSitePlusiQ8N2I9

Expressioni

Tissue specificityi

Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000196182 Expressed in 171 organ(s), highest expression level in skeletal muscle tissue
GenevisibleiQ8N2I9 HS

Organism-specific databases

HPAiHPA008026

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TRIB1Q96RU82EBI-716112,EBI-492555

Protein-protein interaction databases

BioGridi123816, 23 interactors
IntActiQ8N2I9, 9 interactors
MINTiQ8N2I9
STRINGi9606.ENSP00000362221

Structurei

Secondary structure

1435
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8N2I9
SMRiQ8N2I9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 331Protein kinasePROSITE-ProRule annotationAdd BLAST297

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0583 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00900000140868
HOVERGENiHBG080296
InParanoidiQ8N2I9
KOiK16312
OMAiPFILGPR
OrthoDBiEOG091G0AGV
PhylomeDBiQ8N2I9
TreeFamiTF329785

Family and domain databases

CDDicd13974 STKc_SHIK, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR024236 Ser/Thr_kinase_40
IPR008271 Ser/Thr_kinase_AS
IPR024104 Tribbles/Ser_Thr_kinase_40
PANTHERiPTHR22961 PTHR22961, 1 hit
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N2I9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV
60 70 80 90 100
QCLARKDGTD DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL
110 120 130 140 150
HTQDGVVHHH GLFQDRTCEI VEDTESSRMV KKMKKRICLV LDCLCAHDFS
160 170 180 190 200
DKTADLINLQ HYVIKEKRLS ERETVVIFYD VVRVVEALHQ KNIVHRDLKL
210 220 230 240 250
GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI SPDVLSGRPY
260 270 280 290 300
RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS
310 320 330 340 350
ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD
360 370 380 390 400
IDDQMSNADS SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP
410 420 430
KRQFGSAPPV RRLGHDAQPM TSLDTAILAQ RYLRK
Length:435
Mass (Da):49,001
Last modified:October 17, 2006 - v2
Checksum:iEBA7A19963582BCC
GO
Isoform 2 (identifier: Q8N2I9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):18,956
Checksum:iF219891A6F5C9AE1
GO
Isoform 3 (identifier: Q8N2I9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
     418-435: Missing.

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):46,393
Checksum:i33C6B3B9131B8B77
GO
Isoform 4 (identifier: Q8N2I9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: L → LALCAV

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,459
Checksum:i75428BCF0DE3717C
GO

Sequence cautioni

The sequence AAH08344 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15794 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11361 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191Missing in BAC11371 (PubMed:14702039).Curated1
Sequence conflicti363E → Q in AAH05169 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04120010A → V1 PublicationCorresponds to variant dbSNP:rs56314546Ensembl.1
Natural variantiVAR_041201133M → T in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs755089893Ensembl.1
Natural variantiVAR_041202211R → Q in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs539738963Ensembl.1
Natural variantiVAR_041203395A → T3 PublicationsCorresponds to variant dbSNP:rs3795498Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0208961 – 262Missing in isoform 2. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_02089737L → LALCAV in isoform 4. 1 Publication1
Alternative sequenceiVSP_020898263 – 295VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_020899364 – 417AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_020900418 – 435Missing in isoform 3. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY198395 mRNA Translation: AAP20040.1
AK024504 mRNA Translation: BAB15794.1 Different initiation.
AK075029 mRNA Translation: BAC11361.1 Different initiation.
AK075048 mRNA Translation: BAC11371.1
AK131560 mRNA Translation: BAD18694.1
AL834137 mRNA Translation: CAD38852.1
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07371.1
CH471059 Genomic DNA Translation: EAX07373.1
BC005169 mRNA Translation: AAH05169.3
BC007835 mRNA Translation: AAH07835.2
BC008344 mRNA Translation: AAH08344.1 Different initiation.
CCDSiCCDS407.1 [Q8N2I9-1]
CCDS60089.1 [Q8N2I9-4]
RefSeqiNP_001269475.1, NM_001282546.1 [Q8N2I9-4]
NP_001269476.1, NM_001282547.1 [Q8N2I9-1]
NP_114406.1, NM_032017.2 [Q8N2I9-1]
UniGeneiHs.471768

Genome annotation databases

EnsembliENST00000359297; ENSP00000352245; ENSG00000196182 [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182 [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182 [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182 [Q8N2I9-1]
GeneIDi83931
KEGGihsa:83931
UCSCiuc001cak.3 human [Q8N2I9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSTK40_HUMAN
AccessioniPrimary (citable) accession number: Q8N2I9
Secondary accession number(s): D3DPS8
, Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: September 12, 2018
This is version 139 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again