Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (11 Dec 2019)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein kinase 40

Gene

STK40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei66ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei196Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi41 – 49ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8N2I9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase 40 (EC:2.7.11.1)
Alternative name(s):
SINK-homologous serine/threonine-protein kinase
Sugen kinase 495
Short name:
SgK495
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STK40
Synonyms:SGK495, SHIK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196182.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21373 STK40

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609437 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N2I9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
83931

Open Targets

More...
OpenTargetsi
ENSG00000196182

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670860

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N2I9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STK40

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116256080

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002522611 – 435Serine/threonine-protein kinase 40Add BLAST435

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N2I9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N2I9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N2I9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N2I9

PeptideAtlas

More...
PeptideAtlasi
Q8N2I9

PRoteomics IDEntifications database

More...
PRIDEi
Q8N2I9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71707 [Q8N2I9-1]
71708 [Q8N2I9-2]
71709 [Q8N2I9-3]
71710 [Q8N2I9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N2I9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N2I9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196182 Expressed in 171 organ(s), highest expression level in skeletal muscle tissue

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N2I9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008026

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q96RU83EBI-716112,EBI-492555

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123816, 50 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N2I9, 21 interactors

Molecular INTeraction database

More...
MINTi
Q8N2I9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362222

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N2I9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1435
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N2I9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 331Protein kinasePROSITE-ProRule annotationAdd BLAST297

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0583 Eukaryota
COG0515 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182986

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N2I9

KEGG Orthology (KO)

More...
KOi
K16312

Identification of Orthologs from Complete Genome Data

More...
OMAi
GNIPPVR

Database of Orthologous Groups

More...
OrthoDBi
1362510at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N2I9

TreeFam database of animal gene trees

More...
TreeFami
TF329785

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13974 STKc_SHIK, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR024236 Ser/Thr_kinase_40
IPR008271 Ser/Thr_kinase_AS
IPR024104 Tribbles/Ser_Thr_kinase_40

The PANTHER Classification System

More...
PANTHERi
PTHR22961 PTHR22961, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N2I9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRRASDRGA GETSARAKAL GSGISGNNAK RAGPFILGPR LGNSPVPSIV
60 70 80 90 100
QCLARKDGTD DFYQLKILTL EERGDQGIES QEERQGKMLL HTEYSLLSLL
110 120 130 140 150
HTQDGVVHHH GLFQDRTCEI VEDTESSRMV KKMKKRICLV LDCLCAHDFS
160 170 180 190 200
DKTADLINLQ HYVIKEKRLS ERETVVIFYD VVRVVEALHQ KNIVHRDLKL
210 220 230 240 250
GNMVLNKRTH RITITNFCLG KHLVSEGDLL KDQRGSPAYI SPDVLSGRPY
260 270 280 290 300
RGKPSDMWAL GVVLFTMLYG QFPFYDSIPQ ELFRKIKAAE YTIPEDGRVS
310 320 330 340 350
ENTVCLIRKL LVLDPQQRLA AADVLEALSA IIASWQSLSS LSGPLQVVPD
360 370 380 390 400
IDDQMSNADS SQEAKVTEEC SQYEFENYMR QQLLLAEEKS SIHDARSWVP
410 420 430
KRQFGSAPPV RRLGHDAQPM TSLDTAILAQ RYLRK
Length:435
Mass (Da):49,001
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEBA7A19963582BCC
GO
Isoform 2 (identifier: Q8N2I9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     263-295: VLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPE → MGLRQGNGTVSLGILATDPAPPTEPSSPTPCLR

Show »
Length:173
Mass (Da):18,956
Checksum:iF219891A6F5C9AE1
GO
Isoform 3 (identifier: Q8N2I9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-417: AKVTEECSQY...PPVRRLGHDA → VSWGGQMGHY...GGKGRLQSSA
     418-435: Missing.

Show »
Length:417
Mass (Da):46,393
Checksum:i33C6B3B9131B8B77
GO
Isoform 4 (identifier: Q8N2I9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: L → LALCAV

Show »
Length:440
Mass (Da):49,459
Checksum:i75428BCF0DE3717C
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH08344 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15794 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11361 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti191Missing in BAC11371 (PubMed:14702039).Curated1
Sequence conflicti363E → Q in AAH05169 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04120010A → V1 PublicationCorresponds to variant dbSNP:rs56314546Ensembl.1
Natural variantiVAR_041201133M → T in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs755089893Ensembl.1
Natural variantiVAR_041202211R → Q in a colorectal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs539738963Ensembl.1
Natural variantiVAR_041203395A → T3 PublicationsCorresponds to variant dbSNP:rs3795498Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0208961 – 262Missing in isoform 2. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_02089737L → LALCAV in isoform 4. 1 Publication1
Alternative sequenceiVSP_020898263 – 295VLFTM…YTIPE → MGLRQGNGTVSLGILATDPA PPTEPSSPTPCLR in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_020899364 – 417AKVTE…LGHDA → VSWGGQMGHYPAPRDRLLGA GRARAEVAATRRPQSFLGLL PQPWGGKGRLQSSA in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_020900418 – 435Missing in isoform 3. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY198395 mRNA Translation: AAP20040.1
AK024504 mRNA Translation: BAB15794.1 Different initiation.
AK075029 mRNA Translation: BAC11361.1 Different initiation.
AK075048 mRNA Translation: BAC11371.1
AK131560 mRNA Translation: BAD18694.1
AL834137 mRNA Translation: CAD38852.1
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07371.1
CH471059 Genomic DNA Translation: EAX07373.1
BC005169 mRNA Translation: AAH05169.3
BC007835 mRNA Translation: AAH07835.2
BC008344 mRNA Translation: AAH08344.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS407.1 [Q8N2I9-1]
CCDS60089.1 [Q8N2I9-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001269475.1, NM_001282546.1 [Q8N2I9-4]
NP_001269476.1, NM_001282547.1 [Q8N2I9-1]
NP_114406.1, NM_032017.2 [Q8N2I9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359297; ENSP00000352245; ENSG00000196182 [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182 [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182 [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182 [Q8N2I9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83931

UCSC genome browser

More...
UCSCi
uc001cak.3 human [Q8N2I9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY198395 mRNA Translation: AAP20040.1
AK024504 mRNA Translation: BAB15794.1 Different initiation.
AK075029 mRNA Translation: BAC11361.1 Different initiation.
AK075048 mRNA Translation: BAC11371.1
AK131560 mRNA Translation: BAD18694.1
AL834137 mRNA Translation: CAD38852.1
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07371.1
CH471059 Genomic DNA Translation: EAX07373.1
BC005169 mRNA Translation: AAH05169.3
BC007835 mRNA Translation: AAH07835.2
BC008344 mRNA Translation: AAH08344.1 Different initiation.
CCDSiCCDS407.1 [Q8N2I9-1]
CCDS60089.1 [Q8N2I9-4]
RefSeqiNP_001269475.1, NM_001282546.1 [Q8N2I9-4]
NP_001269476.1, NM_001282547.1 [Q8N2I9-1]
NP_114406.1, NM_032017.2 [Q8N2I9-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5L2QX-ray2.53A/B/C/D22-339[»]
SMRiQ8N2I9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi123816, 50 interactors
IntActiQ8N2I9, 21 interactors
MINTiQ8N2I9
STRINGi9606.ENSP00000362222

PTM databases

iPTMnetiQ8N2I9
PhosphoSitePlusiQ8N2I9

Polymorphism and mutation databases

BioMutaiSTK40
DMDMi116256080

Proteomic databases

jPOSTiQ8N2I9
MassIVEiQ8N2I9
MaxQBiQ8N2I9
PaxDbiQ8N2I9
PeptideAtlasiQ8N2I9
PRIDEiQ8N2I9
ProteomicsDBi71707 [Q8N2I9-1]
71708 [Q8N2I9-2]
71709 [Q8N2I9-3]
71710 [Q8N2I9-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
83931

Genome annotation databases

EnsembliENST00000359297; ENSP00000352245; ENSG00000196182 [Q8N2I9-3]
ENST00000373129; ENSP00000362221; ENSG00000196182 [Q8N2I9-1]
ENST00000373130; ENSP00000362222; ENSG00000196182 [Q8N2I9-4]
ENST00000373132; ENSP00000362224; ENSG00000196182 [Q8N2I9-1]
GeneIDi83931
KEGGihsa:83931
UCSCiuc001cak.3 human [Q8N2I9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83931
DisGeNETi83931
EuPathDBiHostDB:ENSG00000196182.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STK40
HGNCiHGNC:21373 STK40
HPAiHPA008026
MIMi609437 gene
neXtProtiNX_Q8N2I9
OpenTargetsiENSG00000196182
PharmGKBiPA142670860

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0583 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00950000182986
InParanoidiQ8N2I9
KOiK16312
OMAiGNIPPVR
OrthoDBi1362510at2759
PhylomeDBiQ8N2I9
TreeFamiTF329785

Enzyme and pathway databases

SignaLinkiQ8N2I9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STK40 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
STK40

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83931
PharosiQ8N2I9 Tbio

Protein Ontology

More...
PROi
PR:Q8N2I9
RNActiQ8N2I9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196182 Expressed in 171 organ(s), highest expression level in skeletal muscle tissue
GenevisibleiQ8N2I9 HS

Family and domain databases

CDDicd13974 STKc_SHIK, 1 hit
InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR024236 Ser/Thr_kinase_40
IPR008271 Ser/Thr_kinase_AS
IPR024104 Tribbles/Ser_Thr_kinase_40
PANTHERiPTHR22961 PTHR22961, 1 hit
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTK40_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N2I9
Secondary accession number(s): D3DPS8
, Q5VTK8, Q5VTK9, Q6ZMN1, Q8N2J8, Q8N3I6, Q96HN6, Q96I44, Q9BSA3, Q9H7H6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: December 11, 2019
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again