Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (08 May 2019)
Sequence version 2 (20 Mar 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho GTPase-activating protein 24

Gene

ARHGAP24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, GTPase activation
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8N264

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GTPase-activating protein 24
Alternative name(s):
Filamin-A-associated RhoGAP
Short name:
FilGAP
RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
Short name:
RC-GAP72
Rho-type GTPase-activating protein 24
RhoGAP of 73 kDa
Sarcoma antigen NY-SAR-88
p73RhoGAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGAP24
Synonyms:FILGAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25361 ARHGAP24

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610586 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N264

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi175R → A: Loss of function. 2 Publications1
Mutagenesisi175R → K: Does not abolish the effect on actin stress fibers but moderates its capability to induce membrane protrusions. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
83478

MalaCards human disease database

More...
MalaCardsi
ARHGAP24

Open Targets

More...
OpenTargetsi
ENSG00000138639

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134934054

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGAP24

Domain mapping of disease mutations (DMDM)

More...
DMDMi
134035016

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002804731 – 748Rho GTPase-activating protein 24Add BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei369PhosphoserineBy similarity1
Modified residuei391Phosphoserine1 Publication1
Modified residuei396PhosphoserineBy similarity1
Modified residuei398PhosphoserineBy similarity1
Modified residuei402Phosphoserine1 Publication1
Modified residuei413Phosphoserine1 Publication1
Modified residuei415PhosphoserineCombined sources1 Publication1
Modified residuei437Phosphoserine1 Publication1
Modified residuei452Phosphothreonine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by ROCK, leading to activate the RacGAP activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N264

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N264

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N264

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N264

PeptideAtlas

More...
PeptideAtlasi
Q8N264

PRoteomics IDEntifications database

More...
PRIDEi
Q8N264

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71656
71657 [Q8N264-2]
71658 [Q8N264-3]
71659 [Q8N264-4]
71660 [Q8N264-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N264

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N264

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells.3 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138639 Expressed in 204 organ(s), highest expression level in metanephros

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N264 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N264 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014288

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FLNA.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123663, 1 interactor

Database of interacting proteins

More...
DIPi
DIP-35520N

Protein interaction database and analysis system

More...
IntActi
Q8N264, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378611

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 125PHPROSITE-ProRule annotationAdd BLAST107
Domaini135 – 329Rho-GAPPROSITE-ProRule annotationAdd BLAST195

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili649 – 729Sequence analysisAdd BLAST81

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4270 Eukaryota
ENOG410XRR2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183015

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232151

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N264

KEGG Orthology (KO)

More...
KOi
K20642

Identification of Orthologs from Complete Genome Data

More...
OMAi
QLMSMMI

Database of Orthologous Groups

More...
OrthoDBi
917149at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N264

TreeFam database of animal gene trees

More...
TreeFami
TF323577

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 1 hit
PF00620 RhoGAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50238 RHOGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N264-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEENNDSTEN PQQGQGRQNA IKCGWLRKQG GFVKTWHTRW FVLKGDQLYY
60 70 80 90 100
FKDEDETKPL GTIFLPGNKV SEHPCNEENP GKFLFEVVPG GDRDRMTANH
110 120 130 140 150
ESYLLMASTQ NDMEDWVKSI RRVIWGPFGG GIFGQKLEDT VRYEKRYGNR
160 170 180 190 200
LAPMLVEQCV DFIRQRGLKE EGLFRLPGQA NLVKELQDAF DCGEKPSFDS
210 220 230 240 250
NTDVHTVASL LKLYLRELPE PVIPYAKYED FLSCAKLLSK EEEAGVKELA
260 270 280 290 300
KQVKSLPVVN YNLLKYICRF LDEVQSYSGV NKMSVQNLAT VFGPNILRPK
310 320 330 340 350
VEDPLTIMEG TVVVQQLMSV MISKHDCLFP KDAELQSKPQ DGVSNNNEIQ
360 370 380 390 400
KKATMGQLQN KENNNTKDSP SRQCSWDKSE SPQRSSMNNG SPTALSGSKT
410 420 430 440 450
NSPKNSVHKL DVSRSPPLMV KKNPAFNKGS GIVTNGSFSS SNAEGLEKTQ
460 470 480 490 500
TTPNGSLQAR RSSSLKVSGT KMGTHSVQNG TVRMGILNSD TLGNPTNVRN
510 520 530 540 550
MSWLPNGYVT LRDNKQKEQA GELGQHNRLS TYDNVHQQFS MMNLDDKQSI
560 570 580 590 600
DSATWSTSSC EISLPENSNS CRSSTTTCPE QDFFGGNFED PVLDGPPQDD
610 620 630 640 650
LSHPRDYESK SDHRSVGGRS SRATSSSDNS ETFVGNSSSN HSALHSLVSS
660 670 680 690 700
LKQEMTKQKI EYESRIKSLE QRNLTLETEM MSLHDELDQE RKKFTMIEIK
710 720 730 740
MRNAERAKED AEKRNDMLQK EMEQFFSTFG ELTVEPRRTE RGNTIWIQ
Length:748
Mass (Da):84,258
Last modified:March 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i87A8E6DCA6869229
GO
Isoform 2 (identifier: Q8N264-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.
     94-130: DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG → MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK

Show »
Length:655
Mass (Da):73,409
Checksum:i1497D420E9DD3FE5
GO
Isoform 3 (identifier: Q8N264-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:653
Mass (Da):73,290
Checksum:iF6A68FEF1E0A5564
GO
Isoform 4 (identifier: Q8N264-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-246: GV → VS
     247-748: Missing.

Note: No experimental confirmation available.
Show »
Length:246
Mass (Da):28,249
Checksum:i9AC9E1CA3D589430
GO
Isoform 5 (identifier: Q8N264-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MWLRKKDWQI...QQGKSISLIM
     91-94: GDRD → KIFS
     95-748: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):28,221
Checksum:i44E3F4574FA33D77
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RCP5D6RCP5_HUMAN
Rho GTPase-activating protein 24
ARHGAP24
622Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBC2D6RBC2_HUMAN
Rho GTPase-activating protein 24
ARHGAP24
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHH1D6RHH1_HUMAN
Rho GTPase-activating protein 24
ARHGAP24
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAO65178 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti140T → A in BAC03606 (PubMed:14702039).Curated1
Sequence conflicti357Q → L in CAB66581 (PubMed:11230166).Curated1
Sequence conflicti722M → V in BAC03606 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0237111 – 95Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0237121 – 93Missing in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0237131M → MWLRKKDWQIFNEQFLKKEH AVGFCFSKCVLVEFSLKCFK KIKSSYWNNDALAFLGKKFL REKNKMTKKQTRNRQNKFPP KPALRSSPVHRVQHFPLLWK VKEPHYHLFFFAFSYCWSWE PFPSEQQPCPASVLSSQQGK SISLIM in isoform 5. 1 Publication1
Alternative sequenceiVSP_02371491 – 94GDRD → KIFS in isoform 5. 1 Publication4
Alternative sequenceiVSP_02371594 – 130DRMTA…GPFGG → MPEDRNSGGCPAGALASTPF IPKTTYRRIKRCFSFRK in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_02371695 – 748Missing in isoform 5. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_023717245 – 246GV → VS in isoform 4. 1 Publication2
Alternative sequenceiVSP_023718247 – 748Missing in isoform 4. 1 PublicationAdd BLAST502

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136646 mRNA Translation: CAB66581.1
AK091196 mRNA Translation: BAC03606.1
AK130576 mRNA Translation: BAC85384.1
BC047918 mRNA Translation: AAH47918.1
BC098580 mRNA Translation: AAH98580.1
AY211925 mRNA Translation: AAO65178.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34025.1 [Q8N264-1]
CCDS3611.1 [Q8N264-2]
CCDS43246.1 [Q8N264-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A59430

NCBI Reference Sequences

More...
RefSeqi
NP_001020787.2, NM_001025616.2 [Q8N264-1]
NP_001036134.1, NM_001042669.1 [Q8N264-3]
NP_112595.2, NM_031305.2 [Q8N264-2]
XP_011530602.1, XM_011532300.2 [Q8N264-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000264343; ENSP00000264343; ENSG00000138639 [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639 [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639 [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639 [Q8N264-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83478

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83478

UCSC genome browser

More...
UCSCi
uc003hpj.4 human [Q8N264-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136646 mRNA Translation: CAB66581.1
AK091196 mRNA Translation: BAC03606.1
AK130576 mRNA Translation: BAC85384.1
BC047918 mRNA Translation: AAH47918.1
BC098580 mRNA Translation: AAH98580.1
AY211925 mRNA Translation: AAO65178.1 Frameshift.
CCDSiCCDS34025.1 [Q8N264-1]
CCDS3611.1 [Q8N264-2]
CCDS43246.1 [Q8N264-3]
PIRiA59430
RefSeqiNP_001020787.2, NM_001025616.2 [Q8N264-1]
NP_001036134.1, NM_001042669.1 [Q8N264-3]
NP_112595.2, NM_031305.2 [Q8N264-2]
XP_011530602.1, XM_011532300.2 [Q8N264-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi123663, 1 interactor
DIPiDIP-35520N
IntActiQ8N264, 4 interactors
STRINGi9606.ENSP00000378611

PTM databases

iPTMnetiQ8N264
PhosphoSitePlusiQ8N264

Polymorphism and mutation databases

BioMutaiARHGAP24
DMDMi134035016

Proteomic databases

EPDiQ8N264
jPOSTiQ8N264
MaxQBiQ8N264
PaxDbiQ8N264
PeptideAtlasiQ8N264
PRIDEiQ8N264
ProteomicsDBi71656
71657 [Q8N264-2]
71658 [Q8N264-3]
71659 [Q8N264-4]
71660 [Q8N264-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264343; ENSP00000264343; ENSG00000138639 [Q8N264-2]
ENST00000395183; ENSP00000378610; ENSG00000138639 [Q8N264-3]
ENST00000395184; ENSP00000378611; ENSG00000138639 [Q8N264-1]
ENST00000503995; ENSP00000423206; ENSG00000138639 [Q8N264-4]
GeneIDi83478
KEGGihsa:83478
UCSCiuc003hpj.4 human [Q8N264-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83478
DisGeNETi83478

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGAP24

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0004350
HGNCiHGNC:25361 ARHGAP24
HPAiHPA014288
MalaCardsiARHGAP24
MIMi610586 gene
neXtProtiNX_Q8N264
OpenTargetsiENSG00000138639
Orphaneti93213 Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis
PharmGKBiPA134934054

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4270 Eukaryota
ENOG410XRR2 LUCA
GeneTreeiENSGT00950000183015
HOGENOMiHOG000232151
InParanoidiQ8N264
KOiK20642
OMAiQLMSMMI
OrthoDBi917149at2759
PhylomeDBiQ8N264
TreeFamiTF323577

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
SIGNORiQ8N264

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARHGAP24 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ARHGAP24

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83478

Protein Ontology

More...
PROi
PR:Q8N264

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138639 Expressed in 204 organ(s), highest expression level in metanephros
ExpressionAtlasiQ8N264 baseline and differential
GenevisibleiQ8N264 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50238 RHOGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHG24_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N264
Secondary accession number(s): Q4KMG1
, Q6ZNV3, Q86TI5, Q86WE4, Q9H0T6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: May 8, 2019
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again