Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8N1K5 (THMS1_HUMAN)

Entry version 132 (11 Dec 2019)
Sequence version 3 (26 Jun 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein THEMIS

Gene

THEMIS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processAdaptive immunity, Immunity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein THEMIS
Alternative name(s):
Thymocyte-expressed molecule involved in selection
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:THEMIS
Synonyms:C6orf190, C6orf207
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000172673.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:21569 THEMIS

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613607 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8N1K5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		387357

Open Targets

More...OpenTargetsi		ENSG00000172673

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA165618330

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8N1K5 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		THEMIS

Domain mapping of disease mutations (DMDM)

More...DMDMi		150421530

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002523781 – 641Protein THEMISAdd BLAST641

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei584PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Tyr residues quickly after TCR stimulation.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8N1K5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8N1K5

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8N1K5

PeptideAtlas

More...PeptideAtlasi		Q8N1K5

PRoteomics IDEntifications database

More...PRIDEi		Q8N1K5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25677
71609 [Q8N1K5-1]
71610 [Q8N1K5-2]
71611 [Q8N1K5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8N1K5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8N1K5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000172673 Expressed in 105 organ(s), highest expression level in thymus

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8N1K5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8N1K5 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA031422
HPA031425

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PLCG1, ITK, GRB2, and LAT.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		132289, 4 interactors

Protein interaction database and analysis system

More...IntActi		Q8N1K5, 13 interactors

Molecular INTeraction database

More...MINTi		Q8N1K5

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000357231

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8N1K5 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 259CABIT 1Add BLAST259
Regioni260 – 518CABIT 2Add BLAST259

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the themis family.Curated

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063770

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8N1K5

Identification of Orthologs from Complete Genome Data

More...OMAi		KECWEIP

Database of Orthologous Groups

More...OrthoDBi		337909at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8N1K5

TreeFam database of animal gene trees

More...TreeFami		TF333479

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025946 CABIT_dom
IPR039671 THEMIS

The PANTHER Classification System

More...PANTHERi		PTHR15215 PTHR15215, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12736 CABIT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N1K5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALSLEEFVH SLDLRTLPRV LEIQAGIYLE GSIYEMFGNE CCFSTGEVIK 
        60         70         80         90        100
ITGLKVKKII AEICEQIEGC ESLQPFELPM NFPGLFKIVA DKTPYLTMEE 
       110        120        130        140        150
ITRTIHIGPS RLGHPCFYHQ KDIKLENLII KQGEQIMLNS VEEIDGEIMV 
       160        170        180        190        200
SCAVARNHQT HSFNLPLSQE GEFYECEDER IYTLKEIVEW KIPKNRTRTV 
       210        220        230        240        250
NLTDFSNKWD STNPFPKDFY GTLILKPVYE IQGVMKFRKD IIRILPSLDV 
       260        270        280        290        300
EVKDITDSYD ANWFLQLLST EDLFEMTSKE FPIVTEVIEA PEGNHLPQSI 
       310        320        330        340        350
LQPGKTIVIH KKYQASRILA SEIRSNFPKR HFLIPTSYKG KFKRRPREFP 
       360        370        380        390        400
TAYDLEIAKS EKEPLHVVAT KAFHSPHDKL SSVSVGDQFL VHQSETTEVL 
       410        420        430        440        450
CEGIKKVVNV LACEKILKKS YEAALLPLYM EGGFVEVIHD KKQYPISELC 
       460        470        480        490        500
KQFRLPFNVK VSVRDLSIEE DVLAATPGLQ LEEDITDSYL LISDFANPTE 
       510        520        530        540        550
CWEIPVGRLN MTVQLVSNFS RDAEPFLVRT LVEEITEEQY YMMRRYESSA 
       560        570        580        590        600
SHPPPRPPKH PSVEETKLTL LTLAEERTVD LPKSPKRHHV DITKKLHPNQ 
       610        620        630        640 
AGLDSKVLIG SQNDLVDEEK ERSNRGATAI AETFKNEKHQ K
Length:641
Mass (Da):73,452
Last modified:June 26, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i30B5325242212E94
GO
Isoform 2 (identifier: Q8N1K5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Show »
Length:606
Mass (Da):69,464
Checksum:i80D80EBB22A38903
GO
Isoform 3 (identifier: Q8N1K5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: Missing.

Show »
Length:544
Mass (Da):62,568
Checksum:i3BCFA122086FFA1D
GO
Isoform 4 (identifier: Q8N1K5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-586: K → KAGVQWRDLGSLQPLPPGFKQFSASASHVAGITGTPHHVQ

Show »
Length:680
Mass (Da):77,515
Checksum:i949C286B5CC7558F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0D9SFD2A0A0D9SFD2_HUMAN
Protein THEMIS
THEMIS
562Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X1WI26X1WI26_HUMAN
Protein THEMIS
THEMIS
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC05194 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAG52943 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti63I → V in BAF84735 (PubMed:14702039).Curated1
Sequence conflicti72S → F in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti220Y → C in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti482E → K in BAG53994 (PubMed:14702039).Curated1
Sequence conflicti510N → S in CAE45941 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027846284V → G. Corresponds to variant dbSNP:rs11968051Ensembl.1
Natural variantiVAR_027847630I → V4 PublicationsCorresponds to variant dbSNP:rs675531Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0379641 – 97Missing in isoform 3. CuratedAdd BLAST97
Alternative sequenceiVSP_0379651 – 35Missing in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_055714586K → KAGVQWRDLGSLQPLPPGFK QFSASASHVAGITGTPHHVQ in isoform 4. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK094863 mRNA Translation: BAG52943.1 Different initiation.
CH471051 Genomic DNA Translation: EAW48092.1
BC130516 mRNA Translation: AAI30517.1
AK124031 mRNA Translation: BAG53994.1
AK128377 mRNA Translation: BAG54669.1
AK292046 mRNA Translation: BAF84735.1
AL035470 Genomic DNA No translation available.
AL356432 Genomic DNA No translation available.
AL365224 Genomic DNA No translation available.
AK097903 mRNA Translation: BAC05194.1 Sequence problems.
BX640890 mRNA Translation: CAE45941.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34534.1 [Q8N1K5-1]
CCDS55055.1 [Q8N1K5-2]
CCDS55056.1 [Q8N1K5-4]

NCBI Reference Sequences

More...RefSeqi		NP_001010923.1, NM_001010923.2 [Q8N1K5-1]
NP_001158157.1, NM_001164685.1 [Q8N1K5-4]
NP_001158159.1, NM_001164687.1 [Q8N1K5-2]
NP_001305460.1, NM_001318531.1 [Q8N1K5-3]
XP_011534118.1, XM_011535816.1 [Q8N1K5-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000368248; ENSP00000357231; ENSG00000172673 [Q8N1K5-1]
ENST00000368250; ENSP00000357233; ENSG00000172673 [Q8N1K5-1]
ENST00000537166; ENSP00000439863; ENSG00000172673 [Q8N1K5-2]
ENST00000610842; ENSP00000480630; ENSG00000275122 [Q8N1K5-1]
ENST00000613862; ENSP00000480967; ENSG00000275122 [Q8N1K5-1]
ENST00000614155; ENSP00000484170; ENSG00000275122 [Q8N1K5-2]
ENST00000630369; ENSP00000487358; ENSG00000172673 [Q8N1K5-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		387357

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:387357

UCSC genome browser

More...UCSCi		uc010kfb.3 human [Q8N1K5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK094863 mRNA Translation: BAG52943.1 Different initiation.
CH471051 Genomic DNA Translation: EAW48092.1
BC130516 mRNA Translation: AAI30517.1
AK124031 mRNA Translation: BAG53994.1
AK128377 mRNA Translation: BAG54669.1
AK292046 mRNA Translation: BAF84735.1
AL035470 Genomic DNA No translation available.
AL356432 Genomic DNA No translation available.
AL365224 Genomic DNA No translation available.
AK097903 mRNA Translation: BAC05194.1 Sequence problems.
BX640890 mRNA Translation: CAE45941.1
CCDSiCCDS34534.1 [Q8N1K5-1]
CCDS55055.1 [Q8N1K5-2]
CCDS55056.1 [Q8N1K5-4]
RefSeqiNP_001010923.1, NM_001010923.2 [Q8N1K5-1]
NP_001158157.1, NM_001164685.1 [Q8N1K5-4]
NP_001158159.1, NM_001164687.1 [Q8N1K5-2]
NP_001305460.1, NM_001318531.1 [Q8N1K5-3]
XP_011534118.1, XM_011535816.1 [Q8N1K5-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi132289, 4 interactors
IntActiQ8N1K5, 13 interactors
MINTiQ8N1K5
STRINGi9606.ENSP00000357231

PTM databases

iPTMnetiQ8N1K5
PhosphoSitePlusiQ8N1K5

Polymorphism and mutation databases

BioMutaiTHEMIS
DMDMi150421530

Proteomic databases

jPOSTiQ8N1K5
MassIVEiQ8N1K5
MaxQBiQ8N1K5
PeptideAtlasiQ8N1K5
PRIDEiQ8N1K5
ProteomicsDBi25677
71609 [Q8N1K5-1]
71610 [Q8N1K5-2]
71611 [Q8N1K5-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		387357

Genome annotation databases

EnsembliENST00000368248; ENSP00000357231; ENSG00000172673 [Q8N1K5-1]
ENST00000368250; ENSP00000357233; ENSG00000172673 [Q8N1K5-1]
ENST00000537166; ENSP00000439863; ENSG00000172673 [Q8N1K5-2]
ENST00000610842; ENSP00000480630; ENSG00000275122 [Q8N1K5-1]
ENST00000613862; ENSP00000480967; ENSG00000275122 [Q8N1K5-1]
ENST00000614155; ENSP00000484170; ENSG00000275122 [Q8N1K5-2]
ENST00000630369; ENSP00000487358; ENSG00000172673 [Q8N1K5-4]
GeneIDi387357
KEGGihsa:387357
UCSCiuc010kfb.3 human [Q8N1K5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387357
DisGeNETi387357
EuPathDBiHostDB:ENSG00000172673.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		THEMIS
HGNCiHGNC:21569 THEMIS
HPAiHPA031422
HPA031425
MIMi613607 gene
neXtProtiNX_Q8N1K5
OpenTargetsiENSG00000172673
PharmGKBiPA165618330

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00530000063770
InParanoidiQ8N1K5
OMAiKECWEIP
OrthoDBi337909at2759
PhylomeDBiQ8N1K5
TreeFamiTF333479

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		THEMIS human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Protein_THEMIS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		387357
PharosiQ8N1K5 Tbio

Protein Ontology

More...PROi		PR:Q8N1K5
RNActiQ8N1K5 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000172673 Expressed in 105 organ(s), highest expression level in thymus
ExpressionAtlasiQ8N1K5 baseline and differential
GenevisibleiQ8N1K5 HS

Family and domain databases

InterProiView protein in InterPro
IPR025946 CABIT_dom
IPR039671 THEMIS
PANTHERiPTHR15215 PTHR15215, 1 hit
PfamiView protein in Pfam
PF12736 CABIT, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTHMS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N1K5
Secondary accession number(s): A1L4F0
, A8K7N1, B3KT31, B3KW32, B3KY07, F5H1J9, Q5T3C4, Q5T3C5, Q6MZT7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 26, 2007
Last modified: December 11, 2019
This is version 132 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again