Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (17 Jun 2020)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-responsive transcription factor

Gene

CARF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-responsive transcription factor
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein
Calcium-response factor
Short name:
CaRF
Testis development protein NYD-SP24
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CARF
Synonyms:ALS2CR8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138380.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14435 CARF

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607586 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N187

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79800

Open Targets

More...
OpenTargetsi
ENSG00000138380

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24748

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N187 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CARF

Domain mapping of disease mutations (DMDM)

More...
DMDMi
85540610

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000761721 – 725Calcium-responsive transcription factorAdd BLAST725

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N187

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N187

PeptideAtlas

More...
PeptideAtlasi
Q8N187

PRoteomics IDEntifications database

More...
PRIDEi
Q8N187

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
32363
71573 [Q8N187-1]
71574 [Q8N187-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N187

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N187

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138380 Expressed in corpus callosum and 161 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N187 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N187 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000138380 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122897, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N187, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384006

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N187 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus is necessary for DNA-binding. The C-terminus is necessary for transcriptional activation (PubMed:11832226).1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II1S Eukaryota
ENOG410XRIT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013916

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_078252_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N187

KEGG Orthology (KO)

More...
KOi
K21595

Identification of Orthologs from Complete Genome Data

More...
OMAi
IIDNHPA

Database of Orthologous Groups

More...
OrthoDBi
366551at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N187

TreeFam database of animal gene trees

More...
TreeFami
TF333279

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029309 CaRF

The PANTHER Classification System

More...
PANTHERi
PTHR14694 PTHR14694, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15299 ALS2CR8, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N187-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQSNDSLRV NHNDGEESKT SAQVFEHLIC MDSRDSSFGQ NDSPTVLPIT
60 70 80 90 100
TREANNSLIS QNIPGPLTQT QTLSAEQFHL VDQNGQAIQY ELQSLGESNA
110 120 130 140 150
QMMIVASPTE NGQVLRVIPP TQTGMAQVII PQGQLVDVNS PRDVPEEKPS
160 170 180 190 200
NRNLPTVRVD TLADNTSNYI LHPQTSFPLP KKSVTGMLEE PLLGPLQPLS
210 220 230 240 250
SNTPIWACRL RSCEKIGDSY RGYCVSETEL ESVLTFHKQQ TQSVWGTRQS
260 270 280 290 300
PSPAKPATRL MWKSQYVPYD GIPFVNAGSR AVVMECQYGP RRKGFQLKKV
310 320 330 340 350
SEQESRSCQL YKATCPARIY IKKVQKFPEY RVPTDPKIDK KIIRMEQEKA
360 370 380 390 400
FNMLKKNLVD AGGVLRWYVQ LPTQQAHQYH ELETPCLTLS PSPFPVSSLE
410 420 430 440 450
EEETAVRDEN CALPSRLHPQ VAHKIQELVS QGIEQVYAVR KQLRKFVERE
460 470 480 490 500
LFKPDEVPER HNLSFFPTVN DIKNHIHEVQ KSLRNGDTVY NSEIIPATLQ
510 520 530 540 550
WTTDSGNILK ETMTVTFAEG NSPGESITTK VETNQTRGSL SPEPTHLLSS
560 570 580 590 600
LSSFQPKIFT QLQGLQLQPR YTSPDESPAV VSVNNQPSSS PSGLLDTIGS
610 620 630 640 650
AVMNNNSLLL GQSHSLQRDT CLTQNNSTAS TMGNLPEPDQ NLVAMDELVE
660 670 680 690 700
VGDVEDTGNL EGTVHRILLG DVQTIPIQII DNHSALIEEN PESTISVSQV
710 720
KQEPKEPALS MEAKKTVDYK KLSAT
Length:725
Mass (Da):80,698
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i871D8874DF8D1384
GO
Isoform 2 (identifier: Q8N187-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.
     279-309: SRAVVMECQYGPRRKGFQLKKVSEQESRSCQ → TFLKNYFKRFSSSHSPLSKCDFPKVITFLFW
     310-725: Missing.

Show »
Length:207
Mass (Da):23,212
Checksum:iB63FE62A853BF86E
GO
Isoform 3 (identifier: Q8N187-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-102: Missing.

Show »
Length:649
Mass (Da):72,385
Checksum:iA9DE9008C08D9DB8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JI92C9JI92_HUMAN
Calcium-responsive transcription fa...
CARF
623Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JN29C9JN29_HUMAN
Calcium-responsive transcription fa...
CARF
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZI6C9JZI6_HUMAN
Calcium-responsive transcription fa...
CARF
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JT99C9JT99_HUMAN
Calcium-responsive transcription fa...
CARF
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZ91C9JZ91_HUMAN
Calcium-responsive transcription fa...
CARF
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GX63A0A1B0GX63_HUMAN
Calcium-responsive transcription fa...
CARF
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSN4C9JSN4_HUMAN
Calcium-responsive transcription fa...
CARF
21Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC01F8WC01_HUMAN
Calcium-responsive transcription fa...
CARF
419Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JBK9C9JBK9_HUMAN
Calcium-responsive transcription fa...
CARF
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6SXV3F6SXV3_HUMAN
Calcium-responsive transcription fa...
CARF
309Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15088 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB69018 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti238K → E in AAK66819 (Ref. 2) Curated1
Sequence conflicti238K → E in BAB15088 (PubMed:14702039).Curated1
Sequence conflicti286C → R in BAG64929 (PubMed:14702039).Curated1
Sequence conflicti300 – 301VS → SQ in BAB15088 (PubMed:14702039).Curated2
Sequence conflicti465F → L in AAH33777 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0167851 – 102Missing in isoform 2. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_05571327 – 102Missing in isoform 3. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_016786279 – 309SRAVV…SRSCQ → TFLKNYFKRFSSSHSPLSKC DFPKVITFLFW in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016787310 – 725Missing in isoform 2. 1 PublicationAdd BLAST416

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB053309 mRNA Translation: BAB69018.1 Frameshift.
AB053310 mRNA Translation: BAB69019.1
AY032876 mRNA Translation: AAK66819.2
AF454946 mRNA Translation: AAL62330.1
AK025232 mRNA Translation: BAB15088.1 Different initiation.
AK304014 mRNA Translation: BAG64929.1
AC010900 Genomic DNA Translation: AAY24288.1
CH471063 Genomic DNA Translation: EAW70320.1
BC033777 mRNA Translation: AAH33777.1
AL834188 mRNA Translation: CAD38882.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42801.1 [Q8N187-1]
CCDS63091.1 [Q8N187-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001098056.1, NM_001104586.2 [Q8N187-1]
NP_001269839.1, NM_001282910.1 [Q8N187-3]
NP_001269840.1, NM_001282911.1 [Q8N187-3]
NP_001309356.1, NM_001322427.1 [Q8N187-1]
NP_001309357.1, NM_001322428.1 [Q8N187-1]
NP_079020.13, NM_024744.15 [Q8N187-1]
XP_005246915.1, XM_005246858.3 [Q8N187-1]
XP_005246916.1, XM_005246859.3 [Q8N187-1]
XP_011510169.1, XM_011511867.2 [Q8N187-1]
XP_016860450.1, XM_017004961.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000320443; ENSP00000316224; ENSG00000138380 [Q8N187-3]
ENST00000402905; ENSP00000384006; ENSG00000138380 [Q8N187-1]
ENST00000428585; ENSP00000396221; ENSG00000138380 [Q8N187-3]
ENST00000434998; ENSP00000415948; ENSG00000138380 [Q8N187-2]
ENST00000438828; ENSP00000414644; ENSG00000138380 [Q8N187-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79800

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79800

UCSC genome browser

More...
UCSCi
uc002uzn.5 human [Q8N187-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053309 mRNA Translation: BAB69018.1 Frameshift.
AB053310 mRNA Translation: BAB69019.1
AY032876 mRNA Translation: AAK66819.2
AF454946 mRNA Translation: AAL62330.1
AK025232 mRNA Translation: BAB15088.1 Different initiation.
AK304014 mRNA Translation: BAG64929.1
AC010900 Genomic DNA Translation: AAY24288.1
CH471063 Genomic DNA Translation: EAW70320.1
BC033777 mRNA Translation: AAH33777.1
AL834188 mRNA Translation: CAD38882.2
CCDSiCCDS42801.1 [Q8N187-1]
CCDS63091.1 [Q8N187-3]
RefSeqiNP_001098056.1, NM_001104586.2 [Q8N187-1]
NP_001269839.1, NM_001282910.1 [Q8N187-3]
NP_001269840.1, NM_001282911.1 [Q8N187-3]
NP_001309356.1, NM_001322427.1 [Q8N187-1]
NP_001309357.1, NM_001322428.1 [Q8N187-1]
NP_079020.13, NM_024744.15 [Q8N187-1]
XP_005246915.1, XM_005246858.3 [Q8N187-1]
XP_005246916.1, XM_005246859.3 [Q8N187-1]
XP_011510169.1, XM_011511867.2 [Q8N187-1]
XP_016860450.1, XM_017004961.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi122897, 3 interactors
IntActiQ8N187, 3 interactors
STRINGi9606.ENSP00000384006

PTM databases

iPTMnetiQ8N187
PhosphoSitePlusiQ8N187

Polymorphism and mutation databases

BioMutaiCARF
DMDMi85540610

Proteomic databases

jPOSTiQ8N187
PaxDbiQ8N187
PeptideAtlasiQ8N187
PRIDEiQ8N187
ProteomicsDBi32363
71573 [Q8N187-1]
71574 [Q8N187-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34159 170 antibodies

The DNASU plasmid repository

More...
DNASUi
79800

Genome annotation databases

EnsembliENST00000320443; ENSP00000316224; ENSG00000138380 [Q8N187-3]
ENST00000402905; ENSP00000384006; ENSG00000138380 [Q8N187-1]
ENST00000428585; ENSP00000396221; ENSG00000138380 [Q8N187-3]
ENST00000434998; ENSP00000415948; ENSG00000138380 [Q8N187-2]
ENST00000438828; ENSP00000414644; ENSG00000138380 [Q8N187-1]
GeneIDi79800
KEGGihsa:79800
UCSCiuc002uzn.5 human [Q8N187-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79800
DisGeNETi79800
EuPathDBiHostDB:ENSG00000138380.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CARF
HGNCiHGNC:14435 CARF
HPAiENSG00000138380 Low tissue specificity
MIMi607586 gene
neXtProtiNX_Q8N187
OpenTargetsiENSG00000138380
PharmGKBiPA24748

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410II1S Eukaryota
ENOG410XRIT LUCA
GeneTreeiENSGT00390000013916
HOGENOMiCLU_078252_0_0_1
InParanoidiQ8N187
KOiK21595
OMAiIIDNHPA
OrthoDBi366551at2759
PhylomeDBiQ8N187
TreeFamiTF333279

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79800 2 hits in 783 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CARF human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ALS2CR8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79800
PharosiQ8N187 Tbio

Protein Ontology

More...
PROi
PR:Q8N187
RNActiQ8N187 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138380 Expressed in corpus callosum and 161 other tissues
ExpressionAtlasiQ8N187 baseline and differential
GenevisibleiQ8N187 HS

Family and domain databases

InterProiView protein in InterPro
IPR029309 CaRF
PANTHERiPTHR14694 PTHR14694, 1 hit
PfamiView protein in Pfam
PF15299 ALS2CR8, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCARTF_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N187
Secondary accession number(s): B4E1W7
, G3V1K7, Q8ND29, Q8WXC0, Q96J78, Q96Q38, Q96Q39, Q9H712
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: June 17, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again