Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-responsive transcription factor

Gene

CARF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence.2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-responsive transcription factor
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein
Calcium-response factor
Short name:
CaRF
Testis development protein NYD-SP24
Gene namesi
Name:CARF
Synonyms:ALS2CR8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138380.17
HGNCiHGNC:14435 CARF
MIMi607586 gene
neXtProtiNX_Q8N187

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi79800
OpenTargetsiENSG00000138380
PharmGKBiPA24748

Polymorphism and mutation databases

BioMutaiCARF
DMDMi85540610

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000761721 – 725Calcium-responsive transcription factorAdd BLAST725

Proteomic databases

PaxDbiQ8N187
PeptideAtlasiQ8N187
PRIDEiQ8N187
ProteomicsDBi71573
71574 [Q8N187-2]

PTM databases

iPTMnetiQ8N187
PhosphoSitePlusiQ8N187

Expressioni

Gene expression databases

BgeeiENSG00000138380 Expressed in 162 organ(s), highest expression level in corpus callosum
CleanExiHS_ALS2CR8
ExpressionAtlasiQ8N187 baseline and differential
GenevisibleiQ8N187 HS

Organism-specific databases

HPAiHPA034557
HPA043191

Interactioni

Protein-protein interaction databases

BioGridi122897, 3 interactors
IntActiQ8N187, 3 interactors
STRINGi9606.ENSP00000316224

Structurei

3D structure databases

ProteinModelPortaliQ8N187
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The N-terminus is necessary for DNA-binding. The C-terminus is necessary for transcriptional activation (PubMed:11832226).1 Publication

Phylogenomic databases

eggNOGiENOG410II1S Eukaryota
ENOG410XRIT LUCA
GeneTreeiENSGT00390000013916
HOGENOMiHOG000033888
HOVERGENiHBG080829
InParanoidiQ8N187
KOiK21595
OMAiTCMDSRD
OrthoDBiEOG091G0M3G
PhylomeDBiQ8N187
TreeFamiTF333279

Family and domain databases

InterProiView protein in InterPro
IPR029309 CaRF
PfamiView protein in Pfam
PF15299 ALS2CR8, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N187-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQSNDSLRV NHNDGEESKT SAQVFEHLIC MDSRDSSFGQ NDSPTVLPIT
60 70 80 90 100
TREANNSLIS QNIPGPLTQT QTLSAEQFHL VDQNGQAIQY ELQSLGESNA
110 120 130 140 150
QMMIVASPTE NGQVLRVIPP TQTGMAQVII PQGQLVDVNS PRDVPEEKPS
160 170 180 190 200
NRNLPTVRVD TLADNTSNYI LHPQTSFPLP KKSVTGMLEE PLLGPLQPLS
210 220 230 240 250
SNTPIWACRL RSCEKIGDSY RGYCVSETEL ESVLTFHKQQ TQSVWGTRQS
260 270 280 290 300
PSPAKPATRL MWKSQYVPYD GIPFVNAGSR AVVMECQYGP RRKGFQLKKV
310 320 330 340 350
SEQESRSCQL YKATCPARIY IKKVQKFPEY RVPTDPKIDK KIIRMEQEKA
360 370 380 390 400
FNMLKKNLVD AGGVLRWYVQ LPTQQAHQYH ELETPCLTLS PSPFPVSSLE
410 420 430 440 450
EEETAVRDEN CALPSRLHPQ VAHKIQELVS QGIEQVYAVR KQLRKFVERE
460 470 480 490 500
LFKPDEVPER HNLSFFPTVN DIKNHIHEVQ KSLRNGDTVY NSEIIPATLQ
510 520 530 540 550
WTTDSGNILK ETMTVTFAEG NSPGESITTK VETNQTRGSL SPEPTHLLSS
560 570 580 590 600
LSSFQPKIFT QLQGLQLQPR YTSPDESPAV VSVNNQPSSS PSGLLDTIGS
610 620 630 640 650
AVMNNNSLLL GQSHSLQRDT CLTQNNSTAS TMGNLPEPDQ NLVAMDELVE
660 670 680 690 700
VGDVEDTGNL EGTVHRILLG DVQTIPIQII DNHSALIEEN PESTISVSQV
710 720
KQEPKEPALS MEAKKTVDYK KLSAT
Length:725
Mass (Da):80,698
Last modified:January 10, 2006 - v2
Checksum:i871D8874DF8D1384
GO
Isoform 2 (identifier: Q8N187-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.
     279-309: SRAVVMECQYGPRRKGFQLKKVSEQESRSCQ → TFLKNYFKRFSSSHSPLSKCDFPKVITFLFW
     310-725: Missing.

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):23,212
Checksum:iB63FE62A853BF86E
GO
Isoform 3 (identifier: Q8N187-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-102: Missing.

Show »
Length:649
Mass (Da):72,385
Checksum:iA9DE9008C08D9DB8
GO

Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JI92C9JI92_HUMAN
Calcium-responsive transcription fa...
CARF
623Annotation score:
F8WC01F8WC01_HUMAN
Calcium-responsive transcription fa...
CARF
419Annotation score:
F6SXV3F6SXV3_HUMAN
Calcium-responsive transcription fa...
CARF
309Annotation score:
C9JN29C9JN29_HUMAN
Calcium-responsive transcription fa...
CARF
80Annotation score:
F8WDW1F8WDW1_HUMAN
Calcium-responsive transcription fa...
CARF
189Annotation score:
C9JBK9C9JBK9_HUMAN
Calcium-responsive transcription fa...
CARF
131Annotation score:
C9JL40C9JL40_HUMAN
Calcium-responsive transcription fa...
CARF
38Annotation score:
F8WDH0F8WDH0_HUMAN
Calcium-responsive transcription fa...
CARF
33Annotation score:
C9JZI6C9JZI6_HUMAN
Calcium-responsive transcription fa...
CARF
95Annotation score:
C9JCD6C9JCD6_HUMAN
Calcium-responsive transcription fa...
CARF
92Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAB15088 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB69018 differs from that shown. Reason: Frameshift at position 715.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti238K → E in AAK66819 (Ref. 2) Curated1
Sequence conflicti238K → E in BAB15088 (PubMed:14702039).Curated1
Sequence conflicti286C → R in BAG64929 (PubMed:14702039).Curated1
Sequence conflicti300 – 301VS → SQ in BAB15088 (PubMed:14702039).Curated2
Sequence conflicti465F → L in AAH33777 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0167851 – 102Missing in isoform 2. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_05571327 – 102Missing in isoform 3. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_016786279 – 309SRAVV…SRSCQ → TFLKNYFKRFSSSHSPLSKC DFPKVITFLFW in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016787310 – 725Missing in isoform 2. 1 PublicationAdd BLAST416

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053309 mRNA Translation: BAB69018.1 Frameshift.
AB053310 mRNA Translation: BAB69019.1
AY032876 mRNA Translation: AAK66819.2
AF454946 mRNA Translation: AAL62330.1
AK025232 mRNA Translation: BAB15088.1 Different initiation.
AK304014 mRNA Translation: BAG64929.1
AC010900 Genomic DNA Translation: AAY24288.1
CH471063 Genomic DNA Translation: EAW70320.1
BC033777 mRNA Translation: AAH33777.1
AL834188 mRNA Translation: CAD38882.2
CCDSiCCDS42801.1 [Q8N187-1]
CCDS63091.1 [Q8N187-3]
RefSeqiNP_001098056.1, NM_001104586.2 [Q8N187-1]
NP_001269839.1, NM_001282910.1 [Q8N187-3]
NP_001269840.1, NM_001282911.1 [Q8N187-3]
NP_001309356.1, NM_001322427.1 [Q8N187-1]
NP_001309357.1, NM_001322428.1 [Q8N187-1]
NP_079020.13, NM_024744.15 [Q8N187-1]
XP_005246915.1, XM_005246858.3 [Q8N187-1]
XP_005246916.1, XM_005246859.3 [Q8N187-1]
XP_011510169.1, XM_011511867.2 [Q8N187-1]
XP_016860450.1, XM_017004961.1
UniGeneiHs.444982

Genome annotation databases

EnsembliENST00000320443; ENSP00000316224; ENSG00000138380 [Q8N187-3]
ENST00000402905; ENSP00000384006; ENSG00000138380 [Q8N187-1]
ENST00000428585; ENSP00000396221; ENSG00000138380 [Q8N187-3]
ENST00000434998; ENSP00000415948; ENSG00000138380 [Q8N187-2]
ENST00000438828; ENSP00000414644; ENSG00000138380 [Q8N187-1]
GeneIDi79800
KEGGihsa:79800
UCSCiuc002uzn.5 human [Q8N187-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053309 mRNA Translation: BAB69018.1 Frameshift.
AB053310 mRNA Translation: BAB69019.1
AY032876 mRNA Translation: AAK66819.2
AF454946 mRNA Translation: AAL62330.1
AK025232 mRNA Translation: BAB15088.1 Different initiation.
AK304014 mRNA Translation: BAG64929.1
AC010900 Genomic DNA Translation: AAY24288.1
CH471063 Genomic DNA Translation: EAW70320.1
BC033777 mRNA Translation: AAH33777.1
AL834188 mRNA Translation: CAD38882.2
CCDSiCCDS42801.1 [Q8N187-1]
CCDS63091.1 [Q8N187-3]
RefSeqiNP_001098056.1, NM_001104586.2 [Q8N187-1]
NP_001269839.1, NM_001282910.1 [Q8N187-3]
NP_001269840.1, NM_001282911.1 [Q8N187-3]
NP_001309356.1, NM_001322427.1 [Q8N187-1]
NP_001309357.1, NM_001322428.1 [Q8N187-1]
NP_079020.13, NM_024744.15 [Q8N187-1]
XP_005246915.1, XM_005246858.3 [Q8N187-1]
XP_005246916.1, XM_005246859.3 [Q8N187-1]
XP_011510169.1, XM_011511867.2 [Q8N187-1]
XP_016860450.1, XM_017004961.1
UniGeneiHs.444982

3D structure databases

ProteinModelPortaliQ8N187
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122897, 3 interactors
IntActiQ8N187, 3 interactors
STRINGi9606.ENSP00000316224

PTM databases

iPTMnetiQ8N187
PhosphoSitePlusiQ8N187

Polymorphism and mutation databases

BioMutaiCARF
DMDMi85540610

Proteomic databases

PaxDbiQ8N187
PeptideAtlasiQ8N187
PRIDEiQ8N187
ProteomicsDBi71573
71574 [Q8N187-2]

Protocols and materials databases

DNASUi79800
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320443; ENSP00000316224; ENSG00000138380 [Q8N187-3]
ENST00000402905; ENSP00000384006; ENSG00000138380 [Q8N187-1]
ENST00000428585; ENSP00000396221; ENSG00000138380 [Q8N187-3]
ENST00000434998; ENSP00000415948; ENSG00000138380 [Q8N187-2]
ENST00000438828; ENSP00000414644; ENSG00000138380 [Q8N187-1]
GeneIDi79800
KEGGihsa:79800
UCSCiuc002uzn.5 human [Q8N187-1]

Organism-specific databases

CTDi79800
DisGeNETi79800
EuPathDBiHostDB:ENSG00000138380.17
GeneCardsiCARF
HGNCiHGNC:14435 CARF
HPAiHPA034557
HPA043191
MIMi607586 gene
neXtProtiNX_Q8N187
OpenTargetsiENSG00000138380
PharmGKBiPA24748
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II1S Eukaryota
ENOG410XRIT LUCA
GeneTreeiENSGT00390000013916
HOGENOMiHOG000033888
HOVERGENiHBG080829
InParanoidiQ8N187
KOiK21595
OMAiTCMDSRD
OrthoDBiEOG091G0M3G
PhylomeDBiQ8N187
TreeFamiTF333279

Miscellaneous databases

ChiTaRSiCARF human
GeneWikiiALS2CR8
GenomeRNAii79800
PROiPR:Q8N187
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138380 Expressed in 162 organ(s), highest expression level in corpus callosum
CleanExiHS_ALS2CR8
ExpressionAtlasiQ8N187 baseline and differential
GenevisibleiQ8N187 HS

Family and domain databases

InterProiView protein in InterPro
IPR029309 CaRF
PfamiView protein in Pfam
PF15299 ALS2CR8, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCARTF_HUMAN
AccessioniPrimary (citable) accession number: Q8N187
Secondary accession number(s): B4E1W7
, G3V1K7, Q8ND29, Q8WXC0, Q96J78, Q96Q38, Q96Q39, Q9H712
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: November 7, 2018
This is version 118 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again